BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00104 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53209| Best HMM Match : Thyroglobulin_1 (HMM E-Value=9.9e-15) 29 5.1 SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 >SB_53209| Best HMM Match : Thyroglobulin_1 (HMM E-Value=9.9e-15) Length = 104 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/63 (23%), Positives = 25/63 (39%) Frame = +3 Query: 228 RQECWSYLSYLTASKSVCKKEKKYIDGELVVSRGCTWKRQDDFEVGCPTSRNEANEVNLF 407 R W+ +S CK + Y + V G W+ + V P+ N+ N N+ Sbjct: 11 RALAWTGISVPGLFVPECKPDGTYEGMQCHVGTGLCWQYDSIYGVFSPSCENDGNYTNIQ 70 Query: 408 CQT 416 C + Sbjct: 71 CHS 73 >SB_10223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/80 (23%), Positives = 42/80 (52%) Frame = -3 Query: 242 PAFLSQFSRRNK*EFPVSIRILKGSLHSGFTLDEHAQQFTGSLSFTNSARSKTGTRNDSF 63 P F F + + +P ++ I +H+ T+ A+ + +L T+S+ SK GT+ +SF Sbjct: 105 PVFHRDFIAKLRGSYPTAL-IQPKLVHTISTVMNEAELMSLNLD-TDSSASKDGTKLESF 162 Query: 62 AIMMHNKLTRLSENTRDVYR 3 + + +S+N +++ + Sbjct: 163 TEDIQQSNSYISDNLKELLK 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,932,523 Number of Sequences: 59808 Number of extensions: 381533 Number of successful extensions: 823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -