BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00102 (686 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 95 6e-20 SB_27855| Best HMM Match : Brevenin (HMM E-Value=2) 31 0.87 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 28 6.2 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 94.7 bits (225), Expect = 6e-20 Identities = 42/58 (72%), Positives = 51/58 (87%) Frame = +1 Query: 511 VTNSELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELHG 684 V+ ++L+EVVNKLIPDSI KDIEK+C IYPL DV IRKVKVLK+P+F+I KLME+HG Sbjct: 59 VSTNDLKEVVNKLIPDSIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKFDIGKLMEMHG 116 Score = 85.4 bits (202), Expect = 4e-17 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = +2 Query: 341 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITR 508 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITR 57 >SB_27855| Best HMM Match : Brevenin (HMM E-Value=2) Length = 306 Score = 31.1 bits (67), Expect = 0.87 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = -2 Query: 370 LHINVGFDESLPFFNHPPELIGCEVHAVEVAEHITSLHISAINLNLRKD--LSASVSACR 197 LH+N +L NH ++IG + + A I S H S++NL+++K+ +S+ A R Sbjct: 198 LHMNGSQRSNL---NHTSDIIGSQKSNLNNASQIISSHKSSLNLSVKKEEKKRSSIMARR 254 Query: 196 SARETSKTLPFNPSEAIFVPWVRLTSVVPTCLLLN 92 R + L F + + + + C+LLN Sbjct: 255 WKRFRRRLLKFTNGKVMEI-------FIIVCILLN 282 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = -2 Query: 235 LRKDLSASVSACRSARETSKTLPFNPSEAIFVPWVRLTSVVPTCLLLNIDGALTSYQSLR 56 LRK L S + RE + L FNP E+ +V L + ++ + +SL+ Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYVLQAESLKKANNVLQIELEELIKKEKSLK 361 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 39 IVDPFTRKDWYDVKAPSMFSKRQ 107 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +1 Query: 430 EPTQDVLRPAHSGQSNQKENV*NHYTHVTNSELREVVNKLIPDSIAKDIEKACHGIYPLR 609 EPT D RP+H ++ + + ELR+ + + P + D + + P+ Sbjct: 276 EPTPDPSRPSHRPGADNLTR--DDIRQIIQQELRKELRRSNPPNQNYDRNRRTYTGIPIS 333 Query: 610 DVCIRKVKVLKRPR 651 IR+ ++ +RPR Sbjct: 334 SKYIREGRIEERPR 347 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,398,256 Number of Sequences: 59808 Number of extensions: 495466 Number of successful extensions: 1440 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1440 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -