BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00100 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 29 0.14 AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding pr... 26 0.76 AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding pr... 26 0.76 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 1.8 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 5.4 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 7.1 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.1 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 7.1 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 7.1 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 9.4 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 9.4 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 28.7 bits (61), Expect = 0.14 Identities = 15/61 (24%), Positives = 27/61 (44%) Frame = +2 Query: 305 WSKFGDSASDKPGPNPATTNVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNVIFKCRT 484 +SK + S +P P T + S + QRP +LD P+++ +++C Sbjct: 237 YSKKSTTVSYQPVPTGTPTRMLNGEPASQRPSSSQMQRPKVQQLDTAAAPTNHHLYRCPA 296 Query: 485 C 487 C Sbjct: 297 C 297 >AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding protein AgamOBP57 protein. Length = 190 Score = 26.2 bits (55), Expect = 0.76 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 42 LHTINCKIAIG-V*NICFDMPVAEEFQASWADEVEIDQGVLPPPSE 176 LHT K+ + + I + +P+AE F DEVE+ G P E Sbjct: 88 LHTDLAKVVLEHMSTIEWKVPLAEGFIQQCFDEVELTDGAFVPSDE 133 >AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding protein OBP14426 protein. Length = 204 Score = 26.2 bits (55), Expect = 0.76 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 42 LHTINCKIAIG-V*NICFDMPVAEEFQASWADEVEIDQGVLPPPSE 176 LHT K+ + + I + +P+AE F DEVE+ G P E Sbjct: 102 LHTDLAKVVLEHMSTIEWKVPLAEGFIQQCFDEVELTDGAFVPSDE 147 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 193 SPFSTTSEGGGSTPWSISTSSAQE 122 S FST+S G GS S S SSA + Sbjct: 1346 SKFSTSSRGSGSDSGSHSISSAAQ 1369 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.4 bits (48), Expect = 5.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +3 Query: 93 DMPVAEEFQASWADEVEIDQGVLPPPSEVVE 185 D+ +A+ ++ WAD + D + PP + E Sbjct: 287 DVLIADFSRSIWADSIVFDSIITDPPYGIRE 317 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 NVA DV + +K ESQ P D L+P ++ + Sbjct: 74 NVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 NVA DV + +K ESQ P D L+P ++ + Sbjct: 74 NVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 NVA DV + +K ESQ P D L+P ++ + Sbjct: 74 NVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 NVA DV + +K ESQ P D L+P ++ + Sbjct: 74 NVAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 N+A DV + +K ESQ P D L+P ++ + Sbjct: 74 NIAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 9.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 362 NVAEDVFMQFITSKEESQRPDDGELDGLKPPSSNV 466 N+A DV + +K ESQ P D L+P ++ + Sbjct: 74 NIAIDVCDFPVNAKCESQSPGDQTTTTLRPTTTTL 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,339 Number of Sequences: 2352 Number of extensions: 9263 Number of successful extensions: 20 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -