BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00098 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B9.03 |||signal recognition particle receptor alpha subunit... 27 2.6 SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces... 25 8.0 >SPBC3B9.03 |||signal recognition particle receptor alpha subunit Srp101|Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -3 Query: 424 GDNTLIKCNN*TTNTRCIKLIMHLRFRTKQTCYNIAVTYN 305 G L K N N +C++++ H F ++Q N VT++ Sbjct: 11 GGIVLWKKTNSLVNLKCLQVLFHEAFLSEQRTVNNTVTFD 50 >SPAC1834.08 |mak1|phk3|histidine kinase Mak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1639 Score = 25.0 bits (52), Expect = 8.0 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 8 GPQTGSIASTGPSKSSASQNLPRVPRRVPV 97 G GS + +K S+ N+P++PR VPV Sbjct: 598 GECVGSFCNIN-AKGSSLNNIPKLPRFVPV 626 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,211,131 Number of Sequences: 5004 Number of extensions: 42296 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -