BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00098 (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0808 + 7418878-7420476 28 6.2 01_06_1642 + 38857326-38857581,38858577-38858818,38859001-388600... 27 8.2 >12_01_0808 + 7418878-7420476 Length = 532 Score = 27.9 bits (59), Expect = 6.2 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 11 PQTGSIASTGPSKSSASQNLPRVPRRVP 94 PQTGS+AS GP+ + L P +VP Sbjct: 265 PQTGSLASQGPTSFLNNPGLCGFPLQVP 292 >01_06_1642 + 38857326-38857581,38858577-38858818,38859001-38860004, 38860170-38860587,38860673-38860789 Length = 678 Score = 27.5 bits (58), Expect = 8.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 283 YDTLCLEYYKHNSITSAHVPYVYKRNGHIPVSMDEEM*ETYNDNE 149 +DT+ + + I S V R+GH+ V D EM + N NE Sbjct: 382 FDTVRALVFSRHEIVSVSVKIYDSRSGHLDVVFDSEM-KRVNANE 425 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,220,072 Number of Sequences: 37544 Number of extensions: 234189 Number of successful extensions: 402 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 402 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -