BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00098 (579 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31220| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_26128| Best HMM Match : DUF725 (HMM E-Value=7.9) 28 6.3 SB_8443| Best HMM Match : Calx-beta (HMM E-Value=0) 27 8.4 >SB_31220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 5 YGPQTGSIASTGPSKSSASQ 64 YGP+ + AS GPS SASQ Sbjct: 102 YGPRRSADASAGPSSRSASQ 121 >SB_26128| Best HMM Match : DUF725 (HMM E-Value=7.9) Length = 213 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 207 TGISQFLWTKKCKRHTMTMNENSKF*HLFNPL 112 TG + C+ HT +NENS F + PL Sbjct: 109 TGTPSVSFNPSCQLHTYEVNENSDFESSYEPL 140 >SB_8443| Best HMM Match : Calx-beta (HMM E-Value=0) Length = 694 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 226 PYVYKRNGHIPVSMDEEM*E 167 PYV K + H P DEEM E Sbjct: 520 PYVVKEDAHFPTDHDEEMDE 539 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,493,838 Number of Sequences: 59808 Number of extensions: 318844 Number of successful extensions: 501 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 469 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -