BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00097 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 110 5e-26 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 7.0 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 23 7.0 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 7.0 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 7.0 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.2 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 110 bits (264), Expect = 5e-26 Identities = 48/77 (62%), Positives = 59/77 (76%) Frame = +3 Query: 255 KFQVNLDVQHFAPEEISVKTADGYIVVEGKHEEKKDQHGYISRQFTRRYALPEGCTAESV 434 KFQ+NLDVQ F+PEEISVK D ++VEGKHEEK+D HGY+SR F RRY LP+G + Sbjct: 14 KFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADI 73 Query: 435 ESRLSSDGVLSVIAPRK 485 S LSSDG+L++ PRK Sbjct: 74 VSSLSSDGILTITCPRK 90 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 561 WSFTSLRTGPVWAIGILRHP 502 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 561 WSFTSLRTGPVWAIGILRHP 502 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 561 WSFTSLRTGPVWAIGILRHP 502 W T PV+ +GI++ P Sbjct: 152 WHLTGFSIDPVYGLGIIKQP 171 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.4 bits (48), Expect = 7.0 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = -3 Query: 561 WSFTSLRTGPVWAIGILRHP 502 W T PV+ +GI++ P Sbjct: 81 WHLTGFSIDPVYGLGIIKQP 100 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 372 YISRQFTRRYALPEGCTAESVESRLSSDGVLSVIAP 479 Y+S +F +P+GC + L + V +V+ P Sbjct: 661 YLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPP 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,491 Number of Sequences: 2352 Number of extensions: 16060 Number of successful extensions: 43 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -