BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00094 (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g44350.1 68414.m05110 IAA-amino acid hydrolase 6, putative (I... 27 9.0 >At1g44350.1 68414.m05110 IAA-amino acid hydrolase 6, putative (ILL6) / IAA-Ala hydrolase, putative virtually identical to gr1-protein from [Arabidopsis thaliana] GI:3559811; similar to IAA-amino acid hydrolase GI:3421384 from [Arabidopsis thaliana]; contains TIGRfam profile TIGR01891: amidohydrolase; contains Pfam profile PF01546: Peptidase family M20/M25/M40; identical to cDNA IAA-amino acid conjugate hydrolase-like protein (ILL6), partial cds GI:17978837 Length = 464 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +2 Query: 62 FSFQLKCKLHELRNVLYPPILNKPAEFDHV 151 F Q E +N +YPP N A ++H+ Sbjct: 351 FGCQATVNFFEKQNAIYPPTTNNDATYNHL 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,888,713 Number of Sequences: 28952 Number of extensions: 176476 Number of successful extensions: 270 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -