BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00093 (629 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132853-2|CAB60441.2| 424|Caenorhabditis elegans Hypothetical ... 28 4.8 Z70287-8|CAA94301.2| 1717|Caenorhabditis elegans Hypothetical pr... 27 8.4 >AL132853-2|CAB60441.2| 424|Caenorhabditis elegans Hypothetical protein Y80D3A.4 protein. Length = 424 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 127 HDYYLNIRSKNRRYVMKIQIVRRARSTTTSASYLRLRLR 11 HDYY+N++ R V QI+R R +R +L+ Sbjct: 365 HDYYVNVKETPRYSVRLAQILRIIRKIKEEVLQIRSKLQ 403 >Z70287-8|CAA94301.2| 1717|Caenorhabditis elegans Hypothetical protein R09E10.7 protein. Length = 1717 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +2 Query: 287 LYSTNICKTKHSL*KNLILKTYKCSELCNFVSSYLVDTKLFLLYSNSLKKAIF*LTK 457 L+ I + K L L+++ E C V ++D KL +Y N L A + L + Sbjct: 961 LHWETIRREKSELTSMLLVRYKDSQEKCALVIDRILDPKLHRMYQNHLSNAAYFLER 1017 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,450,462 Number of Sequences: 27780 Number of extensions: 233072 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -