BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00090 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g63360.1 68414.m07162 disease resistance protein (CC-NBS-LRR ... 29 3.4 At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR ... 28 6.0 >At1g63360.1 68414.m07162 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 884 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 74 QETIEARLGVQIERSGALISSWGCVRRVALPVFKIHHL 187 +E R GV + R I +W VRR++L KIHHL Sbjct: 494 KEAFIVRAGVGV-REIPKIKNWNVVRRMSLMENKIHHL 530 >At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 893 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 74 QETIEARLGVQIERSGALISSWGCVRRVALPVFKIHHL 187 +E R GV + R + +W VRR++L KIHHL Sbjct: 494 KEAFIVRAGVGV-REIPKVKNWNVVRRMSLMGNKIHHL 530 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,287,062 Number of Sequences: 28952 Number of extensions: 268745 Number of successful extensions: 678 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 678 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -