BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00089 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 26 0.32 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 26 0.32 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 26 0.32 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.7 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 24 1.7 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 23 3.9 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 23 3.9 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 5.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 5.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.0 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 26.2 bits (55), Expect = 0.32 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 2 GLVAFDEFAEVMRKTALHKKLPFNMESTFVRLYFGKDKKR 121 G+V ++R +L+K LP E F FG D++R Sbjct: 11 GIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERR 50 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 26.2 bits (55), Expect = 0.32 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 2 GLVAFDEFAEVMRKTALHKKLPFNMESTFVRLYFGKDKKR 121 G+V ++R +L+K LP E F FG D++R Sbjct: 11 GIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERR 50 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 26.2 bits (55), Expect = 0.32 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 2 GLVAFDEFAEVMRKTALHKKLPFNMESTFVRLYFGKDKKR 121 G+V ++R +L+K LP E F FG D++R Sbjct: 11 GIVCQGTTGNILRGESLNKSLPILHEWKFFDYDFGSDERR 50 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 213 VPSLSHFLNASTPYSSW 163 VPS+ H +T +SSW Sbjct: 160 VPSVKHVAKCATDFSSW 176 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 465 PDDESNHAPRSGHIVNLCDILHHTNGRIVYNDLNSITPEQ 584 P D +HAP+ + D H+ G + N +N E+ Sbjct: 277 PGDHGDHAPKQTVRFKVHDPKAHSKGGTLENTINGRADEE 316 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 3 DLLLLTNSPRLCEKRP 50 DL+ L SP CEK P Sbjct: 76 DLVYLEPSPPFCEKNP 91 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 3 DLLLLTNSPRLCEKRP 50 DL+ L SP CEK P Sbjct: 77 DLVYLEPSPPFCEKNP 92 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 313 FPQGERKISFPYY-MAFNSLLNNMEL 387 FPQ R S PYY + +++N +E+ Sbjct: 309 FPQRNRFSSLPYYKYKYLNVINALEM 334 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 313 FPQGERKISFPYY-MAFNSLLNNMEL 387 FPQ R S PYY + +++N +E+ Sbjct: 309 FPQRNRFSSLPYYKYKYLNVINALEM 334 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 177 PYSSWKSCKN*LNSG*VTSRFLSLPKYRRTNVL 79 PY W K SG V++ +++ +Y R VL Sbjct: 111 PYPDWSFAKYEDCSGIVSAHKIAIDEYERLWVL 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,559 Number of Sequences: 438 Number of extensions: 4290 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -