BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00088 (725 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 76 3e-14 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 60 2e-09 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 56 2e-08 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 56 4e-08 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 48 1e-05 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 45 5e-05 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 45 5e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 41 0.001 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 40 0.002 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 40 0.003 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 39 0.004 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 36 0.033 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 35 0.058 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 34 0.10 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 34 0.13 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.24 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.41 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 31 0.72 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.7 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 30 1.7 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 3.8 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 6.7 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.7 SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) 28 8.9 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 75.8 bits (178), Expect = 3e-14 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = +1 Query: 559 YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVF 723 +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA G +R+TC++ Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIY 167 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +3 Query: 321 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 488 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/64 (54%), Positives = 43/64 (67%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 711 KTGSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI A FG + Sbjct: 562 KTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHV 621 Query: 712 TCVF 723 VF Sbjct: 622 VAVF 625 Score = 72.9 bits (171), Expect = 2e-13 Identities = 32/89 (35%), Positives = 48/89 (53%) Frame = +3 Query: 249 PRWDSVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPD 428 P + +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + Sbjct: 467 PEKSKIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDE 526 Query: 429 YVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 + ++ + Y +PT IQ Q PIA+S R Sbjct: 527 QMMASIRKLEYTQPTQIQCQALPIALSGR 555 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 59.7 bits (138), Expect = 2e-09 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 4/67 (5%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTS 699 +TGSGKT A+ +P +V I P I R + GP AL+LAPTRELAQQI++ FG Sbjct: 146 ETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPL 205 Query: 700 YVRNTCV 720 +R V Sbjct: 206 GIRTVSV 212 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/57 (36%), Positives = 33/57 (57%) Frame = +3 Query: 345 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q PI + R Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNR 139 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 56.4 bits (130), Expect = 2e-08 Identities = 30/86 (34%), Positives = 46/86 (53%), Gaps = 1/86 (1%) Frame = +3 Query: 261 SVSLQPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQ 437 +V QPF K+FY P + K +P E +E+R E + V G P++ + + + Sbjct: 58 TVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKIL 117 Query: 438 QGVKTMGYKEPTPIQAQGWPIAMSER 515 +K Y++PTPIQAQ P+ MS R Sbjct: 118 DVLKKNSYEKPTPIQAQAIPVIMSGR 143 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = +1 Query: 547 KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVF 723 K +Y P + P I G IA+V+ PTRELA QI + F + +R CV+ Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVY 179 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 56.4 bits (130), Expect = 2e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 666 +TGSGKTLAY LP + + + P GD P+AL+L PTREL QQ+ Sbjct: 117 ETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 Score = 46.0 bits (104), Expect = 3e-05 Identities = 24/79 (30%), Positives = 39/79 (49%) Frame = +3 Query: 279 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 458 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 459 YKEPTPIQAQGWPIAMSER 515 ++ PTPIQ Q MS R Sbjct: 92 FQVPTPIQMQSLSCVMSGR 110 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/74 (33%), Positives = 41/74 (55%) Frame = +3 Query: 294 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 473 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 474 PIQAQGWPIAMSER 515 PIQ Q P+ +S R Sbjct: 221 PIQMQVLPVLLSGR 234 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.0 bits (109), Expect = 8e-06 Identities = 27/56 (48%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HT 696 +TGSGKT AY+LP + + Q P+AL +APTRELA+QI A F HT Sbjct: 524 QTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHT 579 Score = 35.5 bits (78), Expect = 0.044 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +3 Query: 369 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 VSG I F E F + + + GY+ PTP+Q PI M+ R Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGR 517 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 4/60 (6%) Frame = +3 Query: 333 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWPI 500 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P+ Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATPL 196 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 559 YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 666 Y P + + P + G G A+V++PTRELAQQI Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/48 (43%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 526 RTKTGSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQI 666 + +TG+GKTL++ LP + + + + +RG P LV+APTRELA+Q+ Sbjct: 116 QARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 45.2 bits (102), Expect = 5e-05 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 2/67 (2%) Frame = +1 Query: 526 RTKTGSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSY 702 + ++G+GKT + + + I+ + G D ALVLAPTRELAQQIQ+V G + Sbjct: 128 QAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMH 187 Query: 703 VR-NTCV 720 V+ + C+ Sbjct: 188 VKCHACI 194 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 45.2 bits (102), Expect = 5e-05 Identities = 26/54 (48%), Positives = 34/54 (62%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGH 693 KTGSGKTLA+++P I + Q DG ALV++PTRELA Q +V G+ Sbjct: 95 KTGSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGN 147 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTS 699 +TGSGKT A++LP + + N P A+ +APTRELA QI A F H + Sbjct: 756 QTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGT 815 Query: 700 YVR 708 +R Sbjct: 816 MLR 818 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +3 Query: 339 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++ R Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 749 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/51 (41%), Positives = 34/51 (66%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAAD 684 KTGSGKTLA+++P +V + + + +G ++++PTREL+ Q VA D Sbjct: 617 KTGSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARD 666 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 40.7 bits (91), Expect = 0.001 Identities = 26/65 (40%), Positives = 35/65 (53%), Gaps = 5/65 (7%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHT 696 +TGSGKTLAY+ P +VH + R G P A ++ P RELA QI + A H Sbjct: 423 QTGSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCHH 481 Query: 697 SYVRN 711 + R+ Sbjct: 482 ARFRS 486 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +1 Query: 502 LCRKEFSWRTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAA 681 L ++ R K G+GKT AY++P + + + ALVL PTRELA Q Q+ Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICI 136 Query: 682 DFG 690 + G Sbjct: 137 ELG 139 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/63 (36%), Positives = 33/63 (52%) Frame = +1 Query: 502 LCRKEFSWRTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAA 681 L ++ R K G+GKT AY++P + + + ALVL PTRELA Q Q+ Sbjct: 82 LAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICI 136 Query: 682 DFG 690 + G Sbjct: 137 ELG 139 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +1 Query: 526 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 702 + ++G+GKT + + + I+ Q +R P ALVL+PTRELA QIQ+V G + S Sbjct: 40 QAQSGTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSV 94 Query: 703 VRNTCV 720 + C+ Sbjct: 95 QCHACI 100 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/63 (33%), Positives = 36/63 (57%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRN 711 +TGSGKT A+++P + G AL+L+PTRELA Q Q+ + G + +++ Sbjct: 326 RTGSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLKS 382 Query: 712 TCV 720 + + Sbjct: 383 SVI 385 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/59 (38%), Positives = 32/59 (54%) Frame = +3 Query: 339 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q PI ++ R Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGR 172 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/45 (51%), Positives = 28/45 (62%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 666 KTGSGKT A+ LP + + + P G A+VL PTRELA QI Sbjct: 52 KTGSGKTAAFALPILQKLCDDP-----YGIFAVVLTPTRELAFQI 91 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 35.9 bits (79), Expect = 0.033 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = +1 Query: 532 KTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 690 +TGSGKT A+ LP + + + P AL+L PTRELA QI + G Sbjct: 9 ETGSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALG 56 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 35.9 bits (79), Expect = 0.033 Identities = 26/70 (37%), Positives = 37/70 (52%), Gaps = 14/70 (20%) Frame = +1 Query: 502 LCRKEFSWRTKTGSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLA 639 L ++ +TGSGKTLA+ +P I HI Q P +G +AL++A Sbjct: 166 LYHRDIIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMA 225 Query: 640 PTRELAQQIQ 669 PTRELA Q++ Sbjct: 226 PTRELALQVK 235 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 35.1 bits (77), Expect = 0.058 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +1 Query: 526 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSY 702 +++TG+GK+L ++LP++ Q P RG G I ++ PTRELA Q + +V+ G S Sbjct: 203 KSETGTGKSLVFLLPSV-----QDP-GRGYGTI--IVVPTRELASQMLYEVSRLLGDKSI 254 Query: 703 V 705 V Sbjct: 255 V 255 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +1 Query: 526 RTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSY 702 ++++G+GKT A++L + ++ P P + L+PT ELA+Q +VA G H + Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPH 202 Query: 703 VR 708 ++ Sbjct: 203 IK 204 Score = 31.9 bits (69), Expect = 0.54 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = +3 Query: 354 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSE 512 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P+ +++ Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALPMLLAD 140 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 619 PIALVLAPTRELAQQIQQVAADFG-HTSYVRNTCV 720 P ALVL+PTRELA QIQ+V G + S + C+ Sbjct: 4 PQALVLSPTRELANQIQKVVLALGDYMSVQCHACI 38 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 535 TGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 663 TG+GKT A++LP + + +P + LV+ PTRELA Q Sbjct: 56 TGTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 396 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSER 515 I FE+ + + + V GYK+PTP+Q PI +R Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKR 913 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 31.5 bits (68), Expect = 0.72 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 3/75 (4%) Frame = +1 Query: 475 PFKLKA---GR*LCRKEFSWRTKTGSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPT 645 P +LKA GR C + + K+G+GKT + + A+ ++ I + ++L PT Sbjct: 38 PIQLKAIPLGR--CGLDLIAQAKSGTGKTCVFSVIALENV-----ITESNCIQIIILTPT 90 Query: 646 RELAQQIQQVAADFG 690 RE+A Q++ V G Sbjct: 91 REIAVQVKDVICAIG 105 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 1.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +3 Query: 381 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 494 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +3 Query: 327 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 458 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +1 Query: 538 GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD 684 GSGK LAY+LP I I + +GP+ L+L + ++ V D Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCED 285 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 211 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 101 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 339 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 431 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 28.3 bits (60), Expect = 6.7 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = -2 Query: 277 GWSETESHLGVACS--ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFH 107 GW T + S AL+RI + ++ C +YRR CC L +W H + Sbjct: 181 GWRVTLRVIAATTSQQALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTN 239 Query: 106 GYYSN 92 Y+S+ Sbjct: 240 TYWSS 244 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 28.3 bits (60), Expect = 6.7 Identities = 21/60 (35%), Positives = 31/60 (51%) Frame = +2 Query: 92 IGIIAVETVVPNLEEATNSAIIRLGLATVAIDLEDLEALVGKKNSLEGRTCDAQMGFCFT 271 + +IAV + P++ EA I GL V I ++D EAL K NS+ +C + C T Sbjct: 1258 VDVIAVG-IGPDVNEAELLEIAEGGLDHV-IRVDDYEALATKLNSILALSCPSGQETCTT 1315 >SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) Length = 816 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/74 (21%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 300 PHPTVLKRSPYEVEEYRNK-HEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTP 476 P P V + S Y +Y H S ++ + ++ P Y+QQ ++ +G Sbjct: 341 PPPLVNQISQYNGSQYNQSLHYSLPSTFQISPVTPSLQPSSVPFYLQQDLEALGRISQPR 400 Query: 477 IQAQGWPIAMSERI 518 + Q P+A +++ Sbjct: 401 VSPQSRPLASGQQV 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,525,865 Number of Sequences: 59808 Number of extensions: 480911 Number of successful extensions: 1282 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 1179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -