BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00085 (737 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.3 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.3 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.4 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 23 7.4 AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 23 7.4 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 23 9.8 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + + CM + L VLT ++ + + +++ + L+VFFL Sbjct: 235 FNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFL 290 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + + CM + L VLT ++ + + +++ + L+VFFL Sbjct: 235 FNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFL 290 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.4 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 477 YALYKQLLNKHQLNLRLSPYIP*FVGSL*FFDYHS*TLLAGVSM 346 Y QL N H L+ R F+G L D + LL+ +S+ Sbjct: 871 YETRLQLFNLHSLSFRRQVSQACFIGGLLLSDTDAPDLLSSISL 914 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.4 bits (48), Expect = 7.4 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + L CM + L +L ++ + + +S+ + L VFFL Sbjct: 231 FNITMRRKTLFYTVNLIIPCMGISFLTILVFYLPSDSGEKVSLSISILLSLTVFFL 286 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 76 KACIKTVKTRNKAFGIHSPI 135 K C V+ +NKA G + P+ Sbjct: 80 KQCFMEVRNKNKADGAYEPV 99 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 23.0 bits (47), Expect = 9.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 180 SIF*FHPQYALLIFANRTVYAESLVTSFNSFYASL 76 SIF H Y + FA+ T Y + V + +SL Sbjct: 45 SIFQTHGAYVVRTFADATAYRDECVQQYAGRGSSL 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 662,846 Number of Sequences: 2352 Number of extensions: 12529 Number of successful extensions: 50 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -