BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00085 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 1.3 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 1.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.2 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + + CM + L VLT ++ + + +++ + L+VFFL Sbjct: 236 FNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFL 291 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 1.3 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + + CM + L VLT ++ + + +++ + L+VFFL Sbjct: 236 FNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFL 291 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 1.7 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 173 FDFTLNMRCLSSLIGL---CMPKALLRVLTVFMQALNNGVISILRGFVYVLNVFFL 15 F+ T+ + L + L CM + L VL ++ + + +S+ + L VFFL Sbjct: 232 FNITMRRKTLFYTVNLIIPCMGISFLTVLVFYLPSDSGEKVSLSISILLSLTVFFL 287 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 5.2 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 210 TNYQA*RLLIGTPR*YLSFFNNVTGDDMSDE-ERDQIDTGAQR 335 T YQ L+ P+ L + +GDD+S E + D D ++ Sbjct: 169 TGYQQYLRLLEVPQINLEWGEGSSGDDLSSEWDSDYTDKSNEK 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,819 Number of Sequences: 438 Number of extensions: 3041 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -