BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00085 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g64790.1 68414.m07346 translational activator family protein ... 29 2.4 At2g25660.1 68415.m03075 expressed protein 29 3.2 At1g61620.1 68414.m06943 expressed protein contains Pfam profile... 28 5.6 >At1g64790.1 68414.m07346 translational activator family protein similar to HsGCN1 [Homo sapiens] GI:2282576 Length = 2440 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -1 Query: 131 GLCMPKALLRVLTVFMQALNNG 66 GLC+PK+L +L VF+Q L +G Sbjct: 2032 GLCLPKSLKPLLPVFLQGLISG 2053 >At2g25660.1 68415.m03075 expressed protein Length = 2146 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +1 Query: 133 ISEDKQRILRVKSKNAFMATAKDICSQITKLRDFLLEHRDNI*ASSIMLLETICL 297 +S + +SK+ F+ + +++C Q LRD L E R S ++LE + L Sbjct: 1336 LSRSTDPAVHSRSKDLFIQSVQNLCLQAENLRDLLEEIRGYYTPPSEVVLEDLSL 1390 >At1g61620.1 68414.m06943 expressed protein contains Pfam profile: PF01363 FYVE zinc finger Length = 310 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 466 QTAFK*ASIKSTTESIYSLVCGVTVVLRLSFLNSFSRCEHVFMMRCA 326 +T K AS S +S C VT+ +S + + S C HVF +CA Sbjct: 204 ETKTKSASSSSYDKSYICPSCKVTLTNTMSLV-ALSSCGHVFCKKCA 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,296,129 Number of Sequences: 28952 Number of extensions: 239432 Number of successful extensions: 544 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 544 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -