BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00084 (629 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 2.0 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.1 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 2.0 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 6/67 (8%) Frame = +1 Query: 292 LSDVPPEHPADSESVALAKDRHFQLYSKIAEEHAQHPHPYET--SVPRQS----AAVAEA 453 +SD P A + + A AK+R +Y + P P E+ P S AA A Sbjct: 702 VSDYSPATAAAAAAAAAAKERELLMYETSSTTTTLTPPPSESGRETPLLSGPSYAAAAAG 761 Query: 454 TLKHSEL 474 T++ EL Sbjct: 762 TIREREL 768 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 6.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 241 QGSDRDYVADKEGFHPILSDVPPEHP 318 +GS AD+ I+SD+ PEHP Sbjct: 423 RGSRTPSEADRVVLERIISDLFPEHP 448 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,207 Number of Sequences: 2352 Number of extensions: 12143 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -