BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00082 (632 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 27 0.13 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 2.8 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 27.1 bits (57), Expect = 0.13 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 270 RQGHGSGEHTINNKKVDPKKAKARHG 193 RQ H S H+++N KK+ +HG Sbjct: 245 RQTHKSPSHSVDNSNSSEKKSSIQHG 270 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 22.6 bits (46), Expect = 2.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 426 KFSVVIASWGLSTVMILRITATVLCISISW 515 KF++ +A + L+T I T V+C SW Sbjct: 4 KFAI-LALFALTTTQIHAATDKVICYYASW 32 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,064 Number of Sequences: 336 Number of extensions: 2869 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -