BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00081 (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 8.7 >SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 412 Score = 25.4 bits (53), Expect = 8.7 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 230 SCLEITERAC*DFGNCTRRGSDMSWNMYI--*TSATHLPSSSGRRRHLPNACCSCSRGTI 403 S LE ++ A + C R GS +S N Y + T L S + R L + S SR I Sbjct: 225 SFLEQSKDASSNLTACNRSGSSLSSNFYSSRLSKKTSLASLNKSRASLQHKIMSLSRNII 284 Query: 404 PQV 412 +V Sbjct: 285 RRV 287 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,726,495 Number of Sequences: 5004 Number of extensions: 52373 Number of successful extensions: 134 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -