BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00081 (747 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical pr... 29 4.6 AL021386-3|CAA16167.1| 330|Caenorhabditis elegans Hypothetical ... 28 6.1 >Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical protein ZC84.6 protein. Length = 1474 Score = 28.7 bits (61), Expect = 4.6 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 103 PQKEKGYVGALYGGIKRCLLDKH 171 P EK Y+ ++ G ++ CL+++H Sbjct: 768 PDNEKAYINSMDGTVRECLINEH 790 >AL021386-3|CAA16167.1| 330|Caenorhabditis elegans Hypothetical protein F57E7.3 protein. Length = 330 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = -2 Query: 632 LSLLVNTLHIGISHLALLNQLPCICPQLLAVPSSYAFSVFSVLPLLPGKFLL 477 L++L T SHL +L + PC+ ++ P Y + S+ ++P F + Sbjct: 153 LAILFRTTDSRESHLKVLEKFPCLPKDIIDKPGFYVLAESSLGLVVPFMFYM 204 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,340,137 Number of Sequences: 27780 Number of extensions: 308404 Number of successful extensions: 780 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -