BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00080 (666 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 38 6e-05 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 3.0 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.9 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 21 6.9 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.1 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 38.3 bits (85), Expect = 6e-05 Identities = 17/44 (38%), Positives = 30/44 (68%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 FE L+ LL + + G+ KP+ IQ+ +IP+ LSG+D+++ A+ Sbjct: 160 FETSGLRPHLLENVKKSGYTKPTAIQKYAIPVILSGRDLMSCAQ 203 Score = 28.3 bits (60), Expect = 0.060 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 9/46 (19%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQV-------DPKKDTIQALIVV--PTRELALQ 619 G+GKT A+ +P++ + + + + Q ++V+ PTRELA+Q Sbjct: 205 GSGKTAAFMLPIIHNLLSDKNPPNTENNCAQPVVVIMSPTRELAIQ 250 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 315 IPPKDRRIKTSDVTDTRGNEFEEFCLKR 398 I K R ++ D+ GN EEF L R Sbjct: 185 ISDKAARPRSLQFVDSEGNILEEFVLSR 212 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 171 LKLETYNHTNYYLSK 127 L+LE HTN+YL++ Sbjct: 236 LELEKEFHTNHYLTR 250 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 171 LKLETYNHTNYYLSK 127 L+LE HTN+YL++ Sbjct: 18 LELEKEFHTNHYLTR 32 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 9.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +3 Query: 609 WHSKHHRFVLNW 644 WH+ FV NW Sbjct: 338 WHTGERPFVCNW 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,478 Number of Sequences: 336 Number of extensions: 2463 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -