BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00080 (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 126 2e-29 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 126 2e-29 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 50 2e-06 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 48 5e-06 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 47 2e-05 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 46 2e-05 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 44 1e-04 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 43 2e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 43 3e-04 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 38 0.007 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 35 0.068 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 34 0.12 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 33 0.16 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 32 0.48 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 31 0.64 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 30 1.9 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 29 2.6 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 29 2.6 SB_59149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_40761| Best HMM Match : UPF0020 (HMM E-Value=9.5e-06) 28 7.9 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 126 bits (303), Expect = 2e-29 Identities = 54/70 (77%), Positives = 65/70 (92%) Frame = +3 Query: 297 WKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIAL 476 WK+ LK+PPKD R KTSDVT T+GNEFE++CLKRELLMGIFEKG++KPSPIQE SIP+AL Sbjct: 23 WKANLKLPPKDNRFKTSDVTATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVAL 82 Query: 477 SGKDVLARAK 506 +G+D+LARAK Sbjct: 83 AGRDILARAK 92 Score = 78.2 bits (184), Expect = 6e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKH 652 GTGKT AY +P+LE+ D K+ IQAL++VPTRELALQTSQICIEL KH Sbjct: 94 GTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 126 bits (303), Expect = 2e-29 Identities = 54/70 (77%), Positives = 65/70 (92%) Frame = +3 Query: 297 WKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIAL 476 WK+ LK+PPKD R KTSDVT T+GNEFE++CLKRELLMGIFEKG++KPSPIQE SIP+AL Sbjct: 23 WKANLKLPPKDNRFKTSDVTATKGNEFEDYCLKRELLMGIFEKGFDKPSPIQEESIPVAL 82 Query: 477 SGKDVLARAK 506 +G+D+LARAK Sbjct: 83 AGRDILARAK 92 Score = 78.2 bits (184), Expect = 6e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKH 652 GTGKT AY +P+LE+ D K+ IQAL++VPTRELALQTSQICIEL KH Sbjct: 94 GTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQTSQICIELGKH 141 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%) Frame = +3 Query: 324 KDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARA 503 KD + ++ + +F +F + + L G+ + G+ P+ IQ+ IP+ALSG+DVL A Sbjct: 35 KDLEDRCKEIGSSEVEKFSDFPISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAA 94 Query: 504 K----KELVKLVLIVFQFW 548 K K L L+ I+ W Sbjct: 95 KTGSGKTLAFLIPIIETLW 113 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKK----DTIQALIVVPTRELALQTSQICIELAKHTDI 661 G+GKT A+ IP++E + +K D + AL++ PTRELA QT ++ +++ D+ Sbjct: 97 GSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDL 151 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 48.4 bits (110), Expect = 5e-06 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +2 Query: 509 GTGKTGAYCIPVLE--QVDPKKDTIQALIVVPTRELALQTSQICIELAKHTDIR 664 G+GKT A+ IP+ E Q K I+ALI+ PTRELALQT + EL + T ++ Sbjct: 328 GSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGLK 381 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/56 (42%), Positives = 34/56 (60%) Frame = +3 Query: 339 KTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 +T+DV +F L LL G+ E G+EKPSPIQ +IP+ G D++A+AK Sbjct: 3 RTTDVLIEEQIDFHSLLLSPTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAK 58 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKHTD 658 GTGKT + + LE V + + IQ +I+ PTRE+A+Q + + H D Sbjct: 60 GTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQVKDVICAIGCHYD 109 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/52 (40%), Positives = 32/52 (61%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKHTDIR 664 G+GKTGA+ +P+L+ + + ALI+ PTRELA Q S+ C L ++ Sbjct: 11 GSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVK 62 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKKELVKLVLIV 536 F +F LK ELL I + G+E PS +Q IP A+ G D++ +AK + K + V Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFV 102 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 494 CKS*EGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQ 619 C++ G GKT + + L+Q++P + L++ TRELA Q Sbjct: 89 CQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQ 130 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKKELVKLVLIV 536 F +F LK ELL I + G+E PS +Q IP A+ G D++ +AK + K + V Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFV 102 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 494 CKS*EGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQ 619 C++ G GKT + + L+Q++P + L++ TRELA Q Sbjct: 89 CQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQ 130 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 44.4 bits (100), Expect = 8e-05 Identities = 20/52 (38%), Positives = 32/52 (61%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKHTDIR 664 GTGKT + I VL+ +D + QAL++ PTRELA Q ++ + L + ++ Sbjct: 44 GTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQIQKVVLALGDYMSVQ 95 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/28 (50%), Positives = 22/28 (78%) Frame = +3 Query: 423 KGWEKPSPIQEASIPIALSGKDVLARAK 506 +G+EKPS IQ+ +I L G+DV+A+A+ Sbjct: 15 EGFEKPSAIQQRAIKPILKGRDVIAQAQ 42 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/52 (40%), Positives = 31/52 (59%) Frame = +2 Query: 497 KS*EGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKH 652 +S GTGKT A+ + +L +VD K Q + + PT ELA QT ++ + KH Sbjct: 148 QSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQTGKVAEAMGKH 199 Score = 38.3 bits (85), Expect = 0.006 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 3/83 (3%) Frame = +3 Query: 252 QQTKGEV-DKSIDDVGWKSKLKIPPKDRRIKTSDVTDT--RGNEFEEFCLKRELLMGIFE 422 + TK E+ + S+ + KL + + + SD + FEE L L G+++ Sbjct: 61 KDTKNELAESSLLTKLLRDKLVVTKHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYD 120 Query: 423 KGWEKPSPIQEASIPIALSGKDV 491 G+ KPS IQE ++P+ L+ V Sbjct: 121 MGFNKPSKIQETALPMLLADPPV 143 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 3/47 (6%) Frame = +2 Query: 488 CTCKS*EGTGKTGAYCIPVLEQV---DPKKDTIQALIVVPTRELALQ 619 C C + GTGKT A+ +P+LE++ + I+ L++ PTRELA+Q Sbjct: 51 CACAA-TGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = +3 Query: 420 EKGWEKPSPIQEASIPIALSGKDVLARA 503 E G+ P+PIQ ++IP+AL GKDV A A Sbjct: 27 ELGFLHPTPIQASTIPVALMGKDVCACA 54 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = +3 Query: 369 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 N FEE L L + + ++KP+P+Q+ SIPI ++G+DV+A A+ Sbjct: 711 NSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQ 756 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 9/56 (16%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVD---------PKKDTIQALIVVPTRELALQTSQICIELAK 649 G+GKT A+ +PV+ + + T QA+ + PTRELA +QI +E K Sbjct: 758 GSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELA---NQIYLEARK 810 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = +3 Query: 369 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 N FEE L L + + ++KP+P+Q+ SIPI ++G+DV+A A+ Sbjct: 134 NSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQ 179 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 6/74 (8%) Frame = +2 Query: 461 NSYCPKWKRCTCKS*EGTGKTGAYCIPVLEQVDPKK------DTIQALIVVPTRELALQT 622 N Y + ++ GTGKT + I +L+++D D QAL++ PTRELA Q Sbjct: 116 NHYVLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQI 175 Query: 623 SQICIELAKHTDIR 664 ++ + L + ++ Sbjct: 176 QKVVLALGDYMHVK 189 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASI 464 F++ LK LL GI+ G+EKPS IQ+ +I Sbjct: 65 FDDMNLKEALLRGIYAYGFEKPSAIQQRAI 94 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 41.1 bits (92), Expect = 8e-04 Identities = 15/44 (34%), Positives = 30/44 (68%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 F E +L+ I G+ +P+P+Q+A++PI ++G+D++A A+ Sbjct: 481 FNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQ 524 Score = 34.7 bits (76), Expect = 0.068 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQV------DPKKDTIQALIVVPTRELALQTSQICIELAKHTD 658 G+GKT AY +PVL + P + + AL V PTRELA QI IE K +D Sbjct: 526 GSGKTAAYMLPVLTSLIKQGLNAPPRSPL-ALCVAPTRELA---KQIYIEARKFSD 577 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/37 (43%), Positives = 26/37 (70%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQ 619 G+GKT A+ +P+L+++ I A+++ PTRELA Q Sbjct: 54 GSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQ 90 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 5/53 (9%) Frame = +2 Query: 509 GTGKTGAYCIPVLE-----QVDPKKDTIQALIVVPTRELALQTSQICIELAKH 652 G+GKT A+ +PV+E Q + T +I+ PTREL+LQT + +L KH Sbjct: 619 GSGKTLAFLVPVVELLYKLQFKTRNGT-GVIIISPTRELSLQTYGVARDLLKH 670 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 35.1 bits (77), Expect = 0.052 Identities = 16/45 (35%), Positives = 29/45 (64%) Frame = +3 Query: 372 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 +FE+ L LL + G++KP+P+Q+ +IPI +D++A A+ Sbjct: 876 QFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQ 920 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 34.7 bits (76), Expect = 0.068 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +3 Query: 420 EKGWEKPSPIQEASIPIALSGKDVLA 497 + +EKP+PIQ +IP+ +SG+D++A Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIA 147 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 527 AYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKHTDIR 664 A IPV+ +D I A+++ PTRELA+Q + C + K ++R Sbjct: 133 AQAIPVIMS---GRDMI-AIVMTPTRELAIQIHRECKKFCKPNNLR 174 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 34.7 bits (76), Expect = 0.068 Identities = 20/78 (25%), Positives = 39/78 (50%) Frame = +3 Query: 273 DKSIDDVGWKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQ 452 D+ +D++ WK+ + I +D F + L EL + +K ++ P+PIQ Sbjct: 48 DEVVDEIRWKNGIHIEGED--------CPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQ 99 Query: 453 EASIPIALSGKDVLARAK 506 S+ +SG+D++ A+ Sbjct: 100 MQSLSCVMSGRDIIGLAE 117 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 5/42 (11%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKK-----DTIQALIVVPTRELALQ 619 G+GKT AY +P+ + K DT ALI+ PTREL Q Sbjct: 119 GSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQ 160 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 375 FEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 F F +++ I + + +P+ IQ ++PIALSG+D++ AK Sbjct: 519 FAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAK 562 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +3 Query: 372 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKKELVKLV 527 EF L + G+ P+PIQ +P+ LSG+DV+ A KL+ Sbjct: 197 EFFHCSFNESLSKNLSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGKLL 248 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 9/61 (14%) Frame = +2 Query: 509 GTGKTGAYCIPVL------EQVDPKKDTIQ---ALIVVPTRELALQTSQICIELAKHTDI 661 G+GKT A+ IP+L +++ D Q ALI+ PTRELA Q + ++ + I Sbjct: 148 GSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGI 207 Query: 662 R 664 R Sbjct: 208 R 208 Score = 31.5 bits (68), Expect = 0.64 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 10/86 (11%) Frame = +3 Query: 279 SIDDVGWKSKL--KIPPKDRRIKTSDVT-DTRGN-------EFEEFCLKRELLMGIFEKG 428 + DD W K ++ +D RI D T+G +++E + +L + + G Sbjct: 61 AFDDRHWTKKNLEEMTERDWRIFREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLG 120 Query: 429 WEKPSPIQEASIPIALSGKDVLARAK 506 ++ P+PIQ +IPI L +D++ A+ Sbjct: 121 YKDPTPIQRQAIPIGLQNRDIIGVAE 146 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 581 ALIVVPTRELALQTSQICIELAKHTDIR 664 ALI+ PTRELALQ ++ AK+T ++ Sbjct: 221 ALIMAPTRELALQVKDHLVKAAKYTSVK 248 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +3 Query: 372 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIA-LSGKDVLARAK 506 E+E + ++L + ++G+ KP+PIQ SIP A L +D++ A+ Sbjct: 131 EWEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAE 176 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +3 Query: 369 NEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIA-LSGKDVLARAK 506 +E+E + ++L + ++G+ KP+PIQ SIP A L +D++ A+ Sbjct: 72 SEWEGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAE 118 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 31.9 bits (69), Expect = 0.48 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 9/66 (13%) Frame = +2 Query: 494 CKS*EGTGKTGAYCIPVLEQV--DPKKDTI-------QALIVVPTRELALQTSQICIELA 646 C + G+GKT AY P++ ++ D ++ I +A IVVP RELA Q + L Sbjct: 420 CAAQTGSGKTLAYLAPLVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLC 479 Query: 647 KHTDIR 664 H R Sbjct: 480 HHARFR 485 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 31.5 bits (68), Expect = 0.64 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 372 EFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAK 506 EF F + +L+ + + G KP PIQE ++P S K +L +++ Sbjct: 161 EFSNFGVHPKLVEKLKKMGITKPVPIQEKALPSVFSHKSLLIKSE 205 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +2 Query: 482 KRCTCKS*EGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQ 619 K KS GTGK+ + +P ++ DP + +IVVPTRELA Q Sbjct: 198 KSLLIKSETGTGKSLVFLLPSVQ--DPGRG-YGTIIVVPTRELASQ 240 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 560 PKKDTIQALIVVPTRELALQTSQICIELAK 649 PKK +A++V PTRELA Q + LAK Sbjct: 201 PKKSGFRAVVVSPTRELAQQIYREFCHLAK 230 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 6/43 (13%) Frame = +2 Query: 509 GTGKTGAYCIPVLEQVDPKK------DTIQALIVVPTRELALQ 619 GTGKT ++ +P++E++ K + L++ PTRELA Q Sbjct: 120 GTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQ 162 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 584 LIVVPTRELALQTSQICIELAKHTDIR 664 L++ PTRELA Q ++ + KH +R Sbjct: 136 LVLCPTRELAQQVQEVAYSVGKHCKLR 162 >SB_59149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 482 KRCTCKS*EGTGKTGAYCIPVLEQVDPKKDTIQALIVVPT 601 ++C C+S G G G YC P+ + + P ++ + PT Sbjct: 56 QQCICQS--GYGGNGDYCFPINQVLPPTSLPVRTEVPTPT 93 >SB_3666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 475 RAIGIEAS*IGDGFSHPFSKIPINNSRFKQNS 380 RA+G+ ++ +G G S PF+ I +NN R N+ Sbjct: 476 RAVGLASADLG-GASDPFAVIEVNNQRLVTNT 506 >SB_40761| Best HMM Match : UPF0020 (HMM E-Value=9.5e-06) Length = 1176 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 324 KDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKD 488 KD+ T+D +DT G +E C+ + + G K + AS +A GK+ Sbjct: 881 KDKDDNTTDTSDTTGGGNKEACIGADSVDSAECDGAGKGEGLDAASKEVACEGKE 935 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,079,723 Number of Sequences: 59808 Number of extensions: 294053 Number of successful extensions: 718 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 709 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -