BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00079 (699 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 46 0.001 UniRef50_Q54WN3 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 383 FFLLRWKDELTARLVLSGYWSP 318 F LLRW DELTA LVLSGYWSP Sbjct: 154 FLLLRWVDELTAHLVLSGYWSP 175 >UniRef50_Q54WN3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 561 Score = 32.7 bits (71), Expect = 8.9 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 628 IISSKFFFNLEIRSDCFNKWNVNLLTKIIMSMDIHIVLVFFMSRI 494 I+ ++F FNL +S FNK N N + DI+I+ F +S I Sbjct: 40 ILENRFLFNLYYQSYLFNKNNENAINFKFQFNDIYILESFILSNI 84 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,011,973 Number of Sequences: 1657284 Number of extensions: 13055167 Number of successful extensions: 26488 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26487 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55371905986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -