BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00079 (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 27 2.6 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 26 4.5 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 27.1 bits (57), Expect = 2.6 Identities = 24/81 (29%), Positives = 38/81 (46%) Frame = +3 Query: 222 LMNYQMSNSLNYCPICSHSFSRWVAHLSCRYLWAPVTT*HQAGCELVLPSKQKKKPMQLN 401 L N M S+N SHS V + S + + + + AG V PS + +K ++LN Sbjct: 396 LGNIYMPQSINNVEPTSHSSISKVVNPSEKVI-SKIERACLAGNGNVHPSIKMEKNLELN 454 Query: 402 PNXXXXXXXXXKINTILFVSR 464 P+ KIN+ + VS+ Sbjct: 455 PHPRTLNATEHKINSRIQVSK 475 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 357 AHSPPGVKWLLEPIDIYNLNAPPTLK 280 A PP +K P+DI N++A LK Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLK 249 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,887,469 Number of Sequences: 5004 Number of extensions: 59495 Number of successful extensions: 120 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -