BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00079 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 3.0 AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 pr... 23 7.0 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 156 ILKVDGIAVTQVQKSAIE*NPILMNYQMSNSLNYC 260 +L++DG +T + + NP L+ ++N+L C Sbjct: 927 VLRLDGNRITSFEVWQLSANPYLVEIALANNLWTC 961 >AY748848-1|AAV28194.1| 148|Anopheles gambiae cytochrome P450 protein. Length = 148 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 530 HPYCFGFFYEPYSLQQLHTTKKSRHE*DGIDFNNN 426 H + + E S+ Q + K + DG+D NNN Sbjct: 109 HRFSYRMITERRSIIQTGSVVKQANTEDGLDANNN 143 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,852 Number of Sequences: 2352 Number of extensions: 13684 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -