BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00079 (699 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022472-1|AAY54888.1| 430|Drosophila melanogaster IP11764p pro... 29 4.6 AE014296-3301|AAF49050.1| 430|Drosophila melanogaster CG13813-P... 29 4.6 >BT022472-1|AAY54888.1| 430|Drosophila melanogaster IP11764p protein. Length = 430 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 6/66 (9%) Frame = -1 Query: 297 APPTLKMNGSKWDNSLGYLTFDSS------LVLDFIR*RIFALVSPQYHLL*VCTYKRFN 136 AP + +G W+N++ Y +S ++DF R V H L CT KR Sbjct: 239 APHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLR 298 Query: 135 DKHFLD 118 D+HF D Sbjct: 299 DEHFPD 304 >AE014296-3301|AAF49050.1| 430|Drosophila melanogaster CG13813-PA protein. Length = 430 Score = 29.5 bits (63), Expect = 4.6 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 6/66 (9%) Frame = -1 Query: 297 APPTLKMNGSKWDNSLGYLTFDSS------LVLDFIR*RIFALVSPQYHLL*VCTYKRFN 136 AP + +G W+N++ Y +S ++DF R V H L CT KR Sbjct: 239 APHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLR 298 Query: 135 DKHFLD 118 D+HF D Sbjct: 299 DEHFPD 304 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,390,239 Number of Sequences: 53049 Number of extensions: 583709 Number of successful extensions: 1258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3067209849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -