BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00078 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 5.1 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.9 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -2 Query: 407 RTTGRSAECMNQMSETAVPLVLSS 336 + G+ +C N MSE V ++L + Sbjct: 170 KENGKEFDCHNYMSELTVDILLET 193 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +3 Query: 144 LACGSQAFIATLLFDPSMSALPIIANKIRQALDCS 248 + CG Q F A F +AL N+I + + S Sbjct: 719 IVCGIQRFAAGFCFTVVYAALLTKTNRISRIFNAS 753 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,382 Number of Sequences: 438 Number of extensions: 4477 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -