BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00078 (720 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g16180.1 68416.m02043 proton-dependent oligopeptide transport... 30 1.3 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 4.1 At4g26190.1 68417.m03770 expressed protein 28 5.4 At4g29310.1 68417.m04190 expressed protein 27 9.5 At1g54610.1 68414.m06228 protein kinase family protein contains ... 27 9.5 >At3g16180.1 68416.m02043 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 591 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 156 SQAFIATLLFDPSMSALPIIANKIRQALDCSPIKGNVSWV 275 S + IA LF M+ I+A+ I A+ S +GNVSW+ Sbjct: 492 SMSSIAASLFGLGMAVANILASVILNAVKNSSKQGNVSWI 531 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 21 RAKAGLIQMFSTHRDCESTAYRSFSIK 101 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At4g26190.1 68417.m03770 expressed protein Length = 1067 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 546 FKTRDATSKPIWIAEIDAIGFFLNTCITAPKSGYN 650 FKT++ KP+++ ++ + + TCI+ K Y+ Sbjct: 944 FKTQEKKDKPLFLKDLRRVWDHIGTCISCGKRKYD 978 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.5 bits (58), Expect = 9.5 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -3 Query: 196 IEGSKSNVAMNAWLPQASYPCGNFSGTSC*KLFILKDR*AVLSQSLCVLNIWIK 35 I G K ++ ++ + + + CG SG K+ + D A LS+++ N W K Sbjct: 85 ISGKKISLRVSVYAGRTGHTCGVASGKLLGKVEVAVDLAAALSRTVAFHNGWKK 138 >At1g54610.1 68414.m06228 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 572 Score = 27.5 bits (58), Expect = 9.5 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 418 RGIMPERL*GRSQPSRIRQGYAHCGAPRVGSSKQCDFTSRVSHSKRETRRRS 573 R IMP GR++ ++ + Y CG+P K+ FT + RE +RS Sbjct: 316 RPIMP----GRTEVEQLHKIYKLCGSPSEDYWKKGKFTHGAIYKPREPYKRS 363 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,066,147 Number of Sequences: 28952 Number of extensions: 332115 Number of successful extensions: 766 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -