BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00075 (806 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 101 3e-23 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 1.6 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 2.7 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 2.7 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 101 bits (241), Expect = 3e-23 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = +1 Query: 88 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVL 255 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVL 56 Score = 40.3 bits (90), Expect = 7e-05 Identities = 17/19 (89%), Positives = 19/19 (100%) Frame = +3 Query: 255 IFDLGGGTFDVSILTIEDG 311 IFDLGGGTFDVSILTI++G Sbjct: 57 IFDLGGGTFDVSILTIDEG 75 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 756 IDFVELLSIKRKSCRSFCTLGIRVE 682 +DF E LS C+ CTLG + E Sbjct: 276 VDFYEELSYDNHPCKRACTLGRKPE 300 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 356 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDSTFRSPVP 231 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 25.0 bits (52), Expect = 2.7 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -1 Query: 356 TSQVGVAGGGFHLEDTILDGKDGHVEGTAAEVKDSTFRSPVP 231 T ++G G + D I D H A + FRSP+P Sbjct: 364 TCRLGECSLGCLVADAIADYYTNHTFHPVAIINAGNFRSPIP 405 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 883,813 Number of Sequences: 2352 Number of extensions: 19980 Number of successful extensions: 57 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -