BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00074 (716 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089583-1|AAL90321.1| 480|Drosophila melanogaster RE11624p pro... 29 8.4 AE014297-2656|AAF55663.2| 480|Drosophila melanogaster CG18493-P... 29 8.4 >AY089583-1|AAL90321.1| 480|Drosophila melanogaster RE11624p protein. Length = 480 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 141 FNSISNIFGNCTLLMRKGDM-YFCTVKFTYND 233 F+SISNIF GD+ Y+C ++ND Sbjct: 278 FSSISNIFAGVAQYQGTGDIEYYCDYLLSFND 309 >AE014297-2656|AAF55663.2| 480|Drosophila melanogaster CG18493-PA protein. Length = 480 Score = 28.7 bits (61), Expect = 8.4 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 141 FNSISNIFGNCTLLMRKGDM-YFCTVKFTYND 233 F+SISNIF GD+ Y+C ++ND Sbjct: 278 FSSISNIFAGVAQYQGTGDIEYYCDYLLSFND 309 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,705,463 Number of Sequences: 53049 Number of extensions: 543841 Number of successful extensions: 957 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3190721655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -