BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00074 (716 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016424-5|AAB65326.1| 282|Caenorhabditis elegans Hypothetical ... 29 4.4 Z81584-1|CAB04679.1| 217|Caenorhabditis elegans Hypothetical pr... 28 7.7 AL132898-8|CAB60959.1| 297|Caenorhabditis elegans Hypothetical ... 28 7.7 >AF016424-5|AAB65326.1| 282|Caenorhabditis elegans Hypothetical protein F39G3.4 protein. Length = 282 Score = 28.7 bits (61), Expect = 4.4 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = +3 Query: 123 YQMIPHFNSISNIFGNCTLLMRKGDMY--FCTVKF--TYNDLGSS*LIRVPLHICVNCLV 290 Y HF++I + G C LL+ G + FCT F T D S L+ V + ++C+V Sbjct: 157 YTGASHFSNIHSYLGVCLLLVYSGQLSFGFCTYLFKCTPKDYQSR-LMPVHRAVGISCMV 215 Query: 291 I 293 + Sbjct: 216 V 216 >Z81584-1|CAB04679.1| 217|Caenorhabditis elegans Hypothetical protein T04C12.1 protein. Length = 217 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 378 IVYLFFLACNVYCVPN**INSI 443 +++L F ACN +C PN N+I Sbjct: 94 VIFLLFAACNSFCHPNSLTNTI 115 >AL132898-8|CAB60959.1| 297|Caenorhabditis elegans Hypothetical protein Y59A8B.11 protein. Length = 297 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 212 STEIHIAFSH*KCTISKNIRN 150 ST IH FSH CT++ N RN Sbjct: 63 STVIHYDFSHSHCTVNYNDRN 83 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,442,263 Number of Sequences: 27780 Number of extensions: 329095 Number of successful extensions: 682 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -