BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00073 (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 24 2.7 AJ697719-1|CAG26912.1| 174|Anopheles gambiae putative odorant-b... 23 8.2 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.2 bits (50), Expect = 2.7 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +1 Query: 349 HQYDENSAENKIARLTAYIRCIQNIMEKNPRNSKMKRTVQEMIDRRKKLLKYLR 510 H YDE+ EN I R + + N + + + ++ +DR ++++ LR Sbjct: 1303 HAYDEDVGENAIVRYRLKMDTMGNFRKFSLDKETGELSLAAPLDREQQMMYDLR 1356 >AJ697719-1|CAG26912.1| 174|Anopheles gambiae putative odorant-binding protein OBPjj9 protein. Length = 174 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 321 LDQCVKFFLSKMCHRKYFFYR 259 +D+C++ C + YFF R Sbjct: 138 VDECLEEMAGSACEQAYFFTR 158 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,198 Number of Sequences: 2352 Number of extensions: 10278 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -