Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00070
         (713 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g07630.1 68418.m00874 nuclear division RFT family protein low...    44   1e-04

>At5g07630.1 68418.m00874 nuclear division RFT family protein low
           similarity to SP|P38206 Nuclear division RFT1 protein
           {Saccharomyces cerevisiae}; contains Pfam profile
           PF04506: Rft protein
          Length = 401

 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 44/72 (61%)
 Frame = +2

Query: 35  HTLLLLYGGEAFVAGGLPVQLLRSHCLAIVLLAINGVTECYSFATMTSSQLNSYNYLMVI 214
           ++L+ L  GE +  G   + L + +CL I++LA+NG +E +  A  T ++L   N +++I
Sbjct: 248 YSLIRLLYGEKWSDGEASLAL-QFYCLYIIVLAMNGTSEAFLHAVGTKNELERSNDMLLI 306

Query: 215 FSVSFLVLSYCL 250
           FS+ ++ L+  L
Sbjct: 307 FSLIYVALNILL 318


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,150,308
Number of Sequences: 28952
Number of extensions: 277485
Number of successful extensions: 609
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 594
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 609
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)