BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00069 (738 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6... 79 1e-13 UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy... 77 6e-13 UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/... 77 6e-13 UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia... 56 7e-07 UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 52 2e-05 UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-... 51 3e-05 UniRef50_Q5KEU0 Cluster: Ubiquitin conjugating enzyme, putative;... 50 5e-05 UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8... 50 5e-05 UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy... 49 1e-04 UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom... 48 3e-04 UniRef50_UPI0000F32B5E Cluster: Ubiquitin-conjugating enzyme E2 ... 47 6e-04 UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ... 46 7e-04 UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;... 46 7e-04 UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 46 0.001 UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla... 45 0.002 UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha... 44 0.005 UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 44 0.005 UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 42 0.012 UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ... 42 0.016 UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti... 42 0.021 UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 38 0.19 UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 38 0.26 UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia... 38 0.26 UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 38 0.26 UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55... 38 0.26 UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein;... 37 0.45 UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 37 0.45 UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 37 0.59 UniRef50_Q9LMG5 Cluster: F16A14.13; n=2; Arabidopsis thaliana|Re... 36 1.0 UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 36 1.0 UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomyc... 36 1.0 UniRef50_UPI0000F2CBB8 Cluster: PREDICTED: similar to 2-5 oligoa... 35 1.8 UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme fam... 35 1.8 UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveola... 35 1.8 UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 35 1.8 UniRef50_UPI0000F2BD05 Cluster: PREDICTED: similar to natural ki... 35 2.4 UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating... 35 2.4 UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia... 35 2.4 UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=6... 35 2.4 UniRef50_O62191 Cluster: Putative uncharacterized protein; n=2; ... 34 3.2 UniRef50_A2EXE5 Cluster: Ubiquitin-conjugating enzyme family pro... 34 3.2 UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=... 34 4.2 UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-... 33 5.5 UniRef50_Q3IJY4 Cluster: Sensor protein; n=1; Pseudoalteromonas ... 33 7.3 UniRef50_A6RYQ0 Cluster: Predicted protein; n=1; Botryotinia fuc... 33 7.3 UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 33 7.3 UniRef50_Q1YJ73 Cluster: Putative uncharacterized protein; n=1; ... 33 9.7 UniRef50_A4VDV1 Cluster: Putative uncharacterized protein; n=3; ... 33 9.7 UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51... 33 9.7 >UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo sapiens (Human) Length = 170 Score = 78.6 bits (185), Expect = 1e-13 Identities = 38/46 (82%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRE-RYSEFKKKVARCVRKSQEDCF 135 VISMLADPN +SPANVDAAKEWRE R EFK+KVARCVRKSQE F Sbjct: 124 VISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAF 169 Score = 40.7 bits (91), Expect = 0.036 Identities = 19/24 (79%), Positives = 21/24 (87%), Gaps = 1/24 (4%) Frame = +2 Query: 323 KEWRESYS-EFKRKVAQCVRKSQE 391 KEWRE + EFKRKVA+CVRKSQE Sbjct: 143 KEWREDRNGEFKRKVARCVRKSQE 166 >UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase; n=1; Arabidopsis thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase - Arabidopsis thaliana Length = 198 Score = 76.6 bits (180), Expect = 6e-13 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQE 126 +ISML+ PNDESPANV+AAKEWR++ EFKKKV+RCVRKSQE Sbjct: 155 IISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVRKSQE 196 Score = 41.1 bits (92), Expect = 0.028 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +2 Query: 323 KEWRESYSEFKRKVAQCVRKSQE 391 KEWR+ EFK+KV++CVRKSQE Sbjct: 174 KEWRDKRDEFKKKVSRCVRKSQE 196 >UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/Metazoa group|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 180 Score = 76.6 bits (180), Expect = 6e-13 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 VISML DPNDES ANVDAAKE+RE Y+EFK+KV RCVR+SQE+ Sbjct: 136 VISMLTDPNDESAANVDAAKEYRENYAEFKRKVTRCVRRSQEE 178 Score = 43.6 bits (98), Expect = 0.005 Identities = 17/24 (70%), Positives = 23/24 (95%) Frame = +2 Query: 323 KEWRESYSEFKRKVAQCVRKSQED 394 KE+RE+Y+EFKRKV +CVR+SQE+ Sbjct: 155 KEYRENYAEFKRKVTRCVRRSQEE 178 >UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 164 Score = 56.4 bits (130), Expect = 7e-07 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 VIS+L+DPN +SPANVDAAK + + Y +KK+V CVR+S E+ Sbjct: 122 VISLLSDPNCKSPANVDAAKLYTDDYPMYKKRVLTCVRRSMEE 164 >UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 201 Score = 51.6 bits (118), Expect = 2e-05 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQE 126 VISML+DP D+SPANV+AA E R ++ +K+ V++CV S E Sbjct: 159 VISMLSDPTDDSPANVEAAVELRNNFNLYKQHVSKCVADSLE 200 >UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); n=1; Rattus norvegicus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans) - Rattus norvegicus Length = 114 Score = 50.8 bits (116), Expect = 3e-05 Identities = 24/35 (68%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRE-RYSEFKKKVA 102 V SMLADPN +SPANVDA EWRE R +EF+++VA Sbjct: 78 VSSMLADPNGDSPANVDAVTEWREDRNAEFQRRVA 112 >UniRef50_Q5KEU0 Cluster: Ubiquitin conjugating enzyme, putative; n=1; Filobasidiella neoformans|Rep: Ubiquitin conjugating enzyme, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 209 Score = 50.4 bits (115), Expect = 5e-05 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = +1 Query: 1 VISMLAD--PNDESPANVDAAKEWRERYSEFKKKVARCVRKSQEDCF 135 VIS+L+ P+ SPANVDAAKE RE Y +KKKV R R+S E+ + Sbjct: 162 VISLLSQDVPDLSSPANVDAAKEVREDYPSYKKKVKRLARRSAEEAY 208 >UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=80; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G2 - Homo sapiens (Human) Length = 165 Score = 50.4 bits (115), Expect = 5e-05 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 V+SMLA+PNDES ANVDA+K WR+ +F K + V+KS Sbjct: 123 VVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKS 162 >UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohymenophorea|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 233 Score = 48.8 bits (111), Expect = 1e-04 Identities = 20/43 (46%), Positives = 33/43 (76%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 ++SML++PN SPANVDA ++R++ E+KKKV + + K+ E+ Sbjct: 190 IVSMLSEPNINSPANVDAGIQFRDKPDEYKKKVRKLIDKALEN 232 >UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 170 Score = 47.6 bits (108), Expect = 3e-04 Identities = 20/44 (45%), Positives = 30/44 (68%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQEDC 132 V+SML+DPN ESP N++AAK ++ E+KK+V + S + C Sbjct: 125 VLSMLSDPNPESPMNIEAAKIYKNDIDEYKKRVRKTAEDSLQYC 168 >UniRef50_UPI0000F32B5E Cluster: Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7).; n=1; Bos taurus|Rep: Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19) (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7). - Bos Taurus Length = 165 Score = 46.8 bits (106), Expect = 6e-04 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKK-KVARCVRKSQE 126 VIS+L DPN + AN DA KE R++ KK K A CVRKSQE Sbjct: 122 VISVLVDPNGDPSANTDAVKERRQKCETVKKRKGACCVRKSQE 164 >UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 323 Score = 46.4 bits (105), Expect = 7e-04 Identities = 19/43 (44%), Positives = 32/43 (74%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 ++S+L DPN SPANVDAA ++R+ ++K++V V +S++D Sbjct: 128 IVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVKMEVERSKQD 170 >UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa; n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 295 Score = 46.4 bits (105), Expect = 7e-04 Identities = 19/43 (44%), Positives = 32/43 (74%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 ++S+L DPN SPANVDAA ++R+ ++K++V V +S++D Sbjct: 128 IVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERSKQD 170 >UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 517 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/40 (47%), Positives = 29/40 (72%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 ++S+L+DPN SPANVDA+ EWR ++KK+ + V K+ Sbjct: 142 LMSILSDPNCSSPANVDASVEWRTDKEQYKKRCLKLVEKA 181 >UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria annulata Length = 170 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQE 126 VISML +PN ESPANVDA + + E++KKV RK+ E Sbjct: 129 VISMLGEPNLESPANVDAGVQLKNDPKEYRKKVKMLTRKTLE 170 >UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 172 Score = 43.6 bits (98), Expect = 0.005 Identities = 19/33 (57%), Positives = 25/33 (75%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKV 99 +I++L PN ESPANVDAA+ RE E++KKV Sbjct: 125 IITLLTSPNCESPANVDAAQHLRENEREYRKKV 157 >UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=2; African swine fever virus|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - African swine fever virus (strain BA71V) (ASFV) Length = 215 Score = 43.6 bits (98), Expect = 0.005 Identities = 22/49 (44%), Positives = 32/49 (65%), Gaps = 5/49 (10%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWR-----ERYSEFKKKVARCVRKSQEDC 132 VIS+L +PN +SPANVDAAK +R E + +V + V+KS ++C Sbjct: 114 VISLLNEPNPDSPANVDAAKSYRKYVYKEDLESYPMEVKKTVKKSLDEC 162 >UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=93; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 42.3 bits (95), Expect = 0.012 Identities = 18/38 (47%), Positives = 27/38 (71%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 S+L+DPN SPAN AA+ ++E E++K+V CV +S Sbjct: 111 SLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQS 148 >UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin conjugating enzyme, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ubiquitin conjugating enzyme, partial - Strongylocentrotus purpuratus Length = 162 Score = 41.9 bits (94), Expect = 0.016 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +1 Query: 1 VISMLADPNDESPANVDAA 57 VISMLADPNDESPANVDAA Sbjct: 74 VISMLADPNDESPANVDAA 92 >UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a) - Homo sapiens (Human) Length = 122 Score = 41.5 bits (93), Expect = 0.021 Identities = 18/42 (42%), Positives = 28/42 (66%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQEDC 132 S+L +PN SPAN AA+ ++E E++K+V+ V +S DC Sbjct: 81 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC 122 >UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 38.3 bits (85), Expect = 0.19 Identities = 16/38 (42%), Positives = 26/38 (68%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 S+ DPN SPAN +AA+ ++ ++ +KV +CVR+S Sbjct: 114 SLFDDPNPASPANGEAAEAFQNNRPKYNEKVQQCVRES 151 >UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 176 Score = 37.9 bits (84), Expect = 0.26 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 S+L DPN SPAN +AA+ + E E+ +KV V +S Sbjct: 135 SLLCDPNPNSPANSEAARLFSENKREYNRKVREIVEQS 172 >UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 159 Score = 37.9 bits (84), Expect = 0.26 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 S+L DPN + PAN DAA E+ ++ KV CVR S Sbjct: 110 SLLCDPNPKDPANCDAAYEYIYDRHLYEMKVRECVRNS 147 >UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 216 Score = 37.9 bits (84), Expect = 0.26 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQE 126 ++ +L PN SPANVDA+ +R+ E+ K+V R R+ E Sbjct: 155 IVVILNSPNISSPANVDASVMYRDNPEEYIKEVIRIAREEDE 196 >UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo sapiens (Human) Length = 152 Score = 37.9 bits (84), Expect = 0.26 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 S+L +PN SPAN AA+ ++E E++K+V+ V +S D Sbjct: 111 SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWND 151 >UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 154 Score = 37.1 bits (82), Expect = 0.45 Identities = 15/44 (34%), Positives = 29/44 (65%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQEDC 132 V S+L +PN + P VD A+E+R +EF++K + +++ ++C Sbjct: 110 VQSLLGNPNPDDPLMVDIAEEYRFNKTEFERKAKKYAQENGKNC 153 >UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 221 Score = 37.1 bits (82), Expect = 0.45 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 S+L +PN SPAN AA+ ++E E++K+V V +S D Sbjct: 180 SLLDEPNPNSPANSQAAQLYQENKREYEKRVTAIVEQSWAD 220 >UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=6; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 156 Score = 36.7 bits (81), Expect = 0.59 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARC 108 S+L +PN+ SP N AA+ W E++KKV C Sbjct: 116 SLLGEPNNRSPLNAVAAELWDADMEEYRKKVLAC 149 >UniRef50_Q9LMG5 Cluster: F16A14.13; n=2; Arabidopsis thaliana|Rep: F16A14.13 - Arabidopsis thaliana (Mouse-ear cress) Length = 356 Score = 35.9 bits (79), Expect = 1.0 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 4/100 (4%) Frame = +2 Query: 77 IRNSKRKLPDVLGKVKKIAS--RSKRIFRKEYIYC*KRAIVTPANILLQTLKNVIHLASP 250 I+ ++RK P K++++ S R K++ ++ + K P+N L + + S Sbjct: 5 IKQTRRKHPASQEKIREVGSSTREKKVSARKSVSF-KEDKKKPSNWLQKQFSRQMSGQS- 62 Query: 251 YDPLTPNPHTSTADVFAYSVSFLQKEWRESY--SEFKRKV 364 YDP+ H + AY+++ ++ W E+Y + FK +V Sbjct: 63 YDPIGEMDHAAAVAATAYAIATFEETWLENYHVTVFKNRV 102 >UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus oryzae Length = 226 Score = 35.9 bits (79), Expect = 1.0 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 ++S+L D SPANVDA R+ E+K +V + V S++D Sbjct: 118 ILSLLDDAEVSSPANVDAGVTLRKEPEEYKSRVRKDVEISKQD 160 >UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomycota|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 223 Score = 35.9 bits (79), Expect = 1.0 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKV 99 S+L +PN+ SP N +AA+ W + EF+KKV Sbjct: 183 SLLGEPNNASPLNGEAAELWDKNPEEFQKKV 213 >UniRef50_UPI0000F2CBB8 Cluster: PREDICTED: similar to 2-5 oligoadenylate synthetase-like protein; n=1; Monodelphis domestica|Rep: PREDICTED: similar to 2-5 oligoadenylate synthetase-like protein - Monodelphis domestica Length = 520 Score = 35.1 bits (77), Expect = 1.8 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 225 KTLYIWHRRTIPLHQIRTRPQLMCLLILFH 314 KTL IW P+HQ++ +P+L CLLI H Sbjct: 359 KTLTIWVDPYDPIHQVKQQPELACLLIEEH 388 >UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 147 Score = 35.1 bits (77), Expect = 1.8 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRK 117 + SMLA+PN +S N +AAK+++ EF+KK + + Sbjct: 105 IASMLAEPNVDSAINNEAAKQYKSDPKEFEKKAKEFINQ 143 >UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveolata|Rep: Ubiquitin carrier protein - Plasmodium berghei Length = 149 Score = 35.1 bits (77), Expect = 1.8 Identities = 18/40 (45%), Positives = 23/40 (57%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQE 126 S+L DPN SPAN +AAK + + K+V CV S E Sbjct: 100 SLLNDPNTASPANPEAAKIFMTDKLLYNKRVLMCVEDSWE 139 >UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 720 Score = 35.1 bits (77), Expect = 1.8 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKS 120 S+L DPN SPAN +AAK + +E+ ++V V K+ Sbjct: 675 SLLCDPNPNSPANPEAAKLYMSDRAEYYRRVKEQVEKT 712 >UniRef50_UPI0000F2BD05 Cluster: PREDICTED: similar to natural killer cell receptor 2B4; n=1; Monodelphis domestica|Rep: PREDICTED: similar to natural killer cell receptor 2B4 - Monodelphis domestica Length = 350 Score = 34.7 bits (76), Expect = 2.4 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 2/69 (2%) Frame = -2 Query: 497 LWARRGRPLSVLTT-SH-QSLSQSKQIMKKGTVIRNNPLGSFSHTVLLSF*TPNRILSTL 324 +W R + ++ + SH Q L Q+K T +NP+ S SHT+ L++ P+ + S+ Sbjct: 146 IWYRGRKQMNTVGKYSHIQLLIQAKNTENSFTCHASNPVSSGSHTINLTWACPSSVYSST 205 Query: 323 SAKMKQNKQ 297 S M+ K+ Sbjct: 206 SGAMEDEKR 214 >UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating enzyme E2R 2 (LOC691764), mRNA; n=5; Amniota|Rep: similar to ubiquitin-conjugating enzyme E2R 2 (LOC691764), mRNA - Rattus norvegicus Length = 182 Score = 34.7 bits (76), Expect = 2.4 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = +1 Query: 1 VISMLADPNDESPANVDAA---KEWRERYSEFKKKVARCVRK 117 VIS+L +PN SPANVDA+ ++WR+ + K+ A +RK Sbjct: 71 VISLLNEPNTFSPANVDASVMFRKWRDSKGK-DKEYAEIIRK 111 >UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 196 Score = 34.7 bits (76), Expect = 2.4 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +1 Query: 7 SMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 S+L DPN SPAN +AA + + +V+ C R S ED Sbjct: 116 SLLTDPNPMSPANNEAAALFVNDRHTYNLRVSMCTRNSWED 156 >UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=61; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 R2 - Homo sapiens (Human) Length = 238 Score = 34.7 bits (76), Expect = 2.4 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = +1 Query: 1 VISMLADPNDESPANVDAA---KEWRERYSEFKKKVARCVRK 117 VIS+L +PN SPANVDA+ ++WR+ + K+ A +RK Sbjct: 127 VISLLNEPNTFSPANVDASVMFRKWRDSKGK-DKEYAEIIRK 167 >UniRef50_O62191 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 2029 Score = 34.3 bits (75), Expect = 3.2 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +2 Query: 200 ANILLQTLKNVIHLASPYDPLTPNPHTSTADVFAYSVSFLQKEWRESYSEFKRK 361 A++ L + I + +DPL+P P + + ++A +V F EW ++ ++ K Sbjct: 814 ADVTLHGTEKCIQMMKAFDPLSPIPEQNYSTLWARAVEFDVDEWTVTFKDYPMK 867 >UniRef50_A2EXE5 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 148 Score = 34.3 bits (75), Expect = 3.2 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +1 Query: 10 MLADPNDESPANVDAAKEWRERYSEFKK 93 +L +PN+ SP N+ AA+E+ E Y++F K Sbjct: 108 ILKNPNNASPINIKAAQEYTENYAQFVK 135 >UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 219 Score = 33.9 bits (74), Expect = 4.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKK 96 V SML DPN SPAN DA + R+ E+ K+ Sbjct: 121 VQSMLCDPNMYSPANTDAMVQCRDHNKEYLKR 152 >UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2; n=2; Endopterygota|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2 - Nasonia vitripennis Length = 156 Score = 33.5 bits (73), Expect = 5.5 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +1 Query: 10 MLADPNDESPANVDAAKEWRERYSEFKKKVARCVRK-SQEDCF*EQKD 150 +L PN P N DAA + + E+KKKVA VRK + E+ +Q++ Sbjct: 81 LLTYPNPIDPLNGDAAAMYLHKPEEYKKKVADYVRKYATEEALRDQEN 128 >UniRef50_Q3IJY4 Cluster: Sensor protein; n=1; Pseudoalteromonas haloplanktis TAC125|Rep: Sensor protein - Pseudoalteromonas haloplanktis (strain TAC 125) Length = 1151 Score = 33.1 bits (72), Expect = 7.3 Identities = 16/57 (28%), Positives = 32/57 (56%) Frame = -2 Query: 470 SVLTTSHQSLSQSKQIMKKGTVIRNNPLGSFSHTVLLSF*TPNRILSTLSAKMKQNK 300 + LT ++Q LSQ+KQ+ ++ TV + + SH +L F + S ++ K + ++ Sbjct: 774 AALTQANQELSQAKQVAEQATVSKTRFFAAASHDLLQPFNAASLFCSLMNEKAQSSE 830 >UniRef50_A6RYQ0 Cluster: Predicted protein; n=1; Botryotinia fuckeliana B05.10|Rep: Predicted protein - Botryotinia fuckeliana B05.10 Length = 637 Score = 33.1 bits (72), Expect = 7.3 Identities = 26/81 (32%), Positives = 37/81 (45%), Gaps = 2/81 (2%) Frame = +1 Query: 73 RYSEFKKKVARCVRKSQEDCF*EQ--KDI*KRIYILLKKGHCDTGKHFTTNTEKRYTFGI 246 +Y FKKKV C+R+ E C E+ KD+ K + G G + N + + Sbjct: 436 KYEYFKKKVFDCLRELGESCSEEELMKDVAKEFRFGSRAGTSVLG--YVAN------YLV 487 Query: 247 AVRSPYTKSAHVHS*CVCLFC 309 A PY K+ H S VC+ C Sbjct: 488 AASKPYNKTLHT-SILVCISC 507 >UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 255 Score = 33.1 bits (72), Expect = 7.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +1 Query: 1 VISMLADPNDESPANVDAAKEWRERYSEFKKKVARCVRKSQED 129 ++S+L D SPANVDA+ R+ E+K V + V S+ D Sbjct: 143 ILSLLDDAEISSPANVDASVMLRKSPDEYKSIVKQHVEDSKND 185 >UniRef50_Q1YJ73 Cluster: Putative uncharacterized protein; n=1; Aurantimonas sp. SI85-9A1|Rep: Putative uncharacterized protein - Aurantimonas sp. SI85-9A1 Length = 595 Score = 32.7 bits (71), Expect = 9.7 Identities = 9/16 (56%), Positives = 16/16 (100%) Frame = -3 Query: 289 SCGRVRIWCKGIVRRC 242 +CGR+R++C+G++RRC Sbjct: 126 ACGRIRLFCRGLLRRC 141 >UniRef50_A4VDV1 Cluster: Putative uncharacterized protein; n=3; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1279 Score = 32.7 bits (71), Expect = 9.7 Identities = 18/82 (21%), Positives = 42/82 (51%) Frame = +2 Query: 2 SFQCSLIQMMRVPLMLMLQKNGENDIRNSKRKLPDVLGKVKKIASRSKRIFRKEYIYC*K 181 S Q S +Q ++ + + Q+N + ++ + KL ++ +I S R+F+ ++ K Sbjct: 726 SIQNSSLQNLKPKQIFIFQQNDKQTVQQDQNKLREINLNQDEIQETSSRLFQSQF----K 781 Query: 182 RAIVTPANILLQTLKNVIHLAS 247 R + +NI+++ + H +S Sbjct: 782 RDFLNDSNIMIKQSNQINHDSS 803 >UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 H - Homo sapiens (Human) Length = 183 Score = 32.7 bits (71), Expect = 9.7 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +1 Query: 10 MLADPNDESPANVDAAKEWRERYSEFKKKVARCVRK-SQEDCF*EQKD 150 +LA PN P N DAA + R E+K+K+ ++K + E+ EQ++ Sbjct: 112 LLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEE 159 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,949,057 Number of Sequences: 1657284 Number of extensions: 15056579 Number of successful extensions: 36467 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 34835 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36465 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 60088620670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -