BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00061 (367 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024350-1|ABC86412.1| 268|Drosophila melanogaster IP09446p pro... 60 9e-10 AE014134-1854|AAF52926.1| 268|Drosophila melanogaster CG13139-P... 60 9e-10 BT003524-1|AAO39528.1| 541|Drosophila melanogaster RE22242p pro... 27 5.7 AE014296-3202|AAF49119.2| 541|Drosophila melanogaster CG32209-P... 27 5.7 >BT024350-1|ABC86412.1| 268|Drosophila melanogaster IP09446p protein. Length = 268 Score = 60.1 bits (139), Expect = 9e-10 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = +2 Query: 260 PYVCYVTLPGGACFGSFQNCPTKAE 334 PY+C+VTLPGG+CFGSFQNCPTKAE Sbjct: 62 PYICFVTLPGGSCFGSFQNCPTKAE 86 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +3 Query: 159 MEALQEFWQVKXXXXXXXXXXXLVIYESVPAAIRP 263 +EALQEFWQ+K LVIYES+P+ +P Sbjct: 28 VEALQEFWQMKQSRGAELKNGALVIYESIPSNSQP 62 >AE014134-1854|AAF52926.1| 268|Drosophila melanogaster CG13139-PA protein. Length = 268 Score = 60.1 bits (139), Expect = 9e-10 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = +2 Query: 260 PYVCYVTLPGGACFGSFQNCPTKAE 334 PY+C+VTLPGG+CFGSFQNCPTKAE Sbjct: 62 PYICFVTLPGGSCFGSFQNCPTKAE 86 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +3 Query: 159 MEALQEFWQVKXXXXXXXXXXXLVIYESVPAAIRP 263 +EALQEFWQ+K LVIYES+P+ +P Sbjct: 28 VEALQEFWQMKQSRGAELKNGALVIYESIPSNSQP 62 >BT003524-1|AAO39528.1| 541|Drosophila melanogaster RE22242p protein. Length = 541 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 260 PYVCYVTLPGGACFGSFQNCPTKA 331 PY Y +P C G+ Q+CPT++ Sbjct: 345 PYTMYFRMPH-RCHGNLQSCPTRS 367 >AE014296-3202|AAF49119.2| 541|Drosophila melanogaster CG32209-PB protein. Length = 541 Score = 27.5 bits (58), Expect = 5.7 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 260 PYVCYVTLPGGACFGSFQNCPTKA 331 PY Y +P C G+ Q+CPT++ Sbjct: 345 PYTMYFRMPH-RCHGNLQSCPTRS 367 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,071,515 Number of Sequences: 53049 Number of extensions: 187192 Number of successful extensions: 392 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 943048980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -