BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00058 (508 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.0 DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 22 3.2 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 22 3.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.2 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.8 bits (49), Expect = 1.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 229 VLQRDRRGKHVPRAVFVDLEPTVVDEVRTGTYRQL 333 VL+ R H+ + D+EPTV RQL Sbjct: 233 VLEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 22.2 bits (45), Expect = 3.2 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 167 GFHARGSTAPSRRCQSVRRLDRCERRCIPSFC 72 GF G +C S RC+ RC FC Sbjct: 24 GFGGFGGLGGRGKCPSNEIFSRCDGRC-QRFC 54 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 22.2 bits (45), Expect = 3.2 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 Query: 167 GFHARGSTAPSRRCQSVRRLDRCERRCIPSFC 72 GF G +C S RC+ RC FC Sbjct: 24 GFGGFGGLGGRGKCPSNEIFSRCDGRC-QRFC 54 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 469 LQGFLVFHSFGGG 507 L+G ++ HS+GGG Sbjct: 656 LRGSIIDHSYGGG 668 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +1 Query: 469 LQGFLVFHSFGGG 507 L+G ++ HS+GGG Sbjct: 694 LRGSIIDHSYGGG 706 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,487 Number of Sequences: 438 Number of extensions: 3437 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -