BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00057 (757 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 3.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 4.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 4.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 4.1 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 9.4 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 3.1 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 362 LPPSLTTSKCQCFMSACTVASSNLRPMRRLASNIVLWGSSPP 237 LPP FMS CTV + M NIVL S P Sbjct: 298 LPPVSYLKAVDAFMSVCTVFVF-MALMEYCLVNIVLGDSDTP 338 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 399 FVFTLICYLDLRFASITDNLEMPVLHVGLHSSI 301 F+ L C LD+++ + ++MP L V S+ Sbjct: 282 FILHLFCLLDVQWRIPFNGIQMPNLMVFYEKSL 314 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 507 VFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYG 614 V Q +A K A + N II+EPT YG Sbjct: 348 VLRHVQAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 753 HLPSGCRRRWISPRRYHP 700 H P+G + WI+ RY P Sbjct: 794 HTPNGIVKTWIAHDRYLP 811 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 Query: 68 PFCIFNQSCYLFLKQ 24 P+C N SCY LK+ Sbjct: 9 PYCRRNFSCYYSLKR 23 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,401 Number of Sequences: 438 Number of extensions: 5619 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -