BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00055 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 25 3.3 X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. 24 5.9 DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. 24 5.9 DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. 24 5.9 AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. 24 5.9 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 23 7.7 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.7 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 433 KHTLSIDFQDYGGTCNKNQI 374 KH LS++ +D GG N+N + Sbjct: 590 KHYLSVEARDNGGRGNRNTV 609 >X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. Length = 131 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 115 RYRGGYCNSKAVCVC 129 >DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSRAVCVC 100 >DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 518 RYRGGYCISQNFFEC 562 RYRGGYC S+ C Sbjct: 86 RYRGGYCNSKAVCVC 100 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 556 RMSC*IDLITRYYNTICSYWPFNFFFVVSALV 651 +M C IDL+ + + W FVV AL+ Sbjct: 371 KMQCWIDLVEAWRWQLYMCWVSGSLFVVPALI 402 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 476 LRDFKPYNAELNLPRYRGG 532 +R F PY A+++ +RGG Sbjct: 1144 MRSFSPYGADVSRGDHRGG 1162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 733,940 Number of Sequences: 2352 Number of extensions: 14691 Number of successful extensions: 66 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -