BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00054 (651 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-tran... 25 1.6 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 6.3 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 8.4 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.4 >AF515527-1|AAM61894.1| 211|Anopheles gambiae glutathione S-transferase D10 protein. Length = 211 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 414 LEEYGETHYHAYEKPVVYFQVL 479 L +YGE H YEK + Y + L Sbjct: 190 LPDYGEFHKELYEKSMEYIKTL 211 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 631 CVHRQEWSLNIPRCAQ 584 C H Q WS N+ C++ Sbjct: 764 CYHDQSWSSNVVDCSR 779 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 73 SGDPNAALHCLRKAGRDHEEFIAALEEYIRNPEKPLS 183 S L+CL K E+ A L + + N + PL+ Sbjct: 329 SSGSTGILYCLAKNPEKQEKLRAELRKIMPNKDSPLT 365 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 586 GHTEECSSSTPVCGHR 633 GH EC++ST + G R Sbjct: 286 GHASECTTSTALDGQR 301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,580 Number of Sequences: 2352 Number of extensions: 12984 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -