BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00051 (730 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 23 3.3 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 5.8 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 584 DNFGH*HFLLVQLLAILFTLISQKGGAGNVSYSY 483 D F H LL+ L +L + Q+G G +++ + Sbjct: 50 DQFFRDHKLLLVLFRVLGVMPIQRGEIGRITFGW 83 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 584 DNFGH*HFLLVQLLAILFTLISQKGGAGNVSYSY 483 D F H LL+ L +L + Q+G G +++ + Sbjct: 50 DQFFRDHKLLLVLFRVLGVMPIQRGEIGRITFGW 83 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 584 DNFGH*HFLLVQLLAILFTLISQKGGAGNVSYSY 483 D F H LL+ L +L + Q+G G +++ + Sbjct: 50 DQFFRDHKLLLVLFRVLGVMPIQRGEIGRITFGW 83 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.8 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +1 Query: 412 ILGLTSVYLLSLTNFY*IYGIS 477 I+ + Y+L+LT+ + +YG+S Sbjct: 247 IIIVVITYVLNLTDLFLVYGMS 268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,578 Number of Sequences: 336 Number of extensions: 3686 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -