BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00051 (730 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98877-12|CAB63409.1| 528|Caenorhabditis elegans Hypothetical p... 31 0.84 U88308-11|AAB42321.1| 154|Caenorhabditis elegans Hypothetical p... 29 2.6 Z81136-3|CAD27610.1| 196|Caenorhabditis elegans Hypothetical pr... 29 4.5 AF324055-1|AAK01416.1| 151|Caenorhabditis elegans Ly-6-related ... 29 4.5 AF016427-6|AAY86198.1| 177|Caenorhabditis elegans Hypothetical ... 29 4.5 >Z98877-12|CAB63409.1| 528|Caenorhabditis elegans Hypothetical protein Y69H2.12 protein. Length = 528 Score = 31.1 bits (67), Expect = 0.84 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 295 PLCTYIWYQDWKCSDCCLGDRCNY 366 PLC WY D C C GD Y Sbjct: 269 PLCNTSWYMDGDCKKSCGGDSAEY 292 >U88308-11|AAB42321.1| 154|Caenorhabditis elegans Hypothetical protein C32E8.1 protein. Length = 154 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 65 SFLEVLSLECYVCENQEDNNGKCVNTIKPCEH 160 S L+ L +EC +C Q ++G V + PC H Sbjct: 79 SDLKTLPIECEICAVQYGDSGMTVPRVLPCGH 110 >Z81136-3|CAD27610.1| 196|Caenorhabditis elegans Hypothetical protein W02B8.5 protein. Length = 196 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 343 CLGDRCNYYIISGSRQNMPFNRIILGLTSV 432 CLGDRCN I + + Q++ I++ L+S+ Sbjct: 165 CLGDRCNSAISTSNCQSLSVLAILVALSSL 194 >AF324055-1|AAK01416.1| 151|Caenorhabditis elegans Ly-6-related protein HOT-3 protein. Length = 151 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 343 CLGDRCNYYIISGSRQNMPFNRIILGLTSV 432 CLGDRCN I + + Q++ I++ L+S+ Sbjct: 120 CLGDRCNSAISTSNCQSLSVLAILVALSSL 149 >AF016427-6|AAY86198.1| 177|Caenorhabditis elegans Hypothetical protein F32D1.11 protein. Length = 177 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 83 SLECYVCENQEDNNGKCVNTIKPCEHN 163 + ECY C + NG C++ CE++ Sbjct: 17 AFECYTCNEELTKNGPCIDRKTICENS 43 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,439,481 Number of Sequences: 27780 Number of extensions: 323843 Number of successful extensions: 834 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 734 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -