BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00050 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 26 0.28 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.36 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.4 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 26.2 bits (55), Expect = 0.28 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -1 Query: 174 LNDIAHLELPSHRPRRILATKGSTSKLTHRHSPLRFSP 61 L D+ LPS R R L + ST H P +F P Sbjct: 372 LQDLRMSPLPSIRNRSGLVSGSSTPGTGREHDPAKFPP 409 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.36 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 10 AFAESTTGTATRPTEKIRRESQ 75 A A TTGT T PT ++R+ Q Sbjct: 250 ATAAMTTGTTTIPTRRLRKRRQ 271 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 153 ELPSHRPRRILATKGSTSKLTHRHSP 76 ELP H P + +K +L+ H P Sbjct: 378 ELPKHLPTSLTKSKMEVMELSDLHHP 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,177 Number of Sequences: 438 Number of extensions: 3746 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -