BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00050 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12630.1 68416.m01572 zinc finger (AN1-like) family protein c... 29 3.6 At5g40680.1 68418.m04938 kelch repeat-containing F-box family pr... 27 8.3 >At3g12630.1 68416.m01572 zinc finger (AN1-like) family protein contains Pfam domain, PF01428: AN1-like Zinc finger Length = 160 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = -1 Query: 138 RPRRILATKGSTSKLTHRHSPLRFSPDLLSGARCRTGGRFC 16 RPR I A K ++ +R S R L +G RCR G FC Sbjct: 83 RPREIDAVKKRDQQIVNRCSGCRKKVGL-TGFRCRCGELFC 122 >At5g40680.1 68418.m04938 kelch repeat-containing F-box family protein contains Pfam:PF01344 Kelch motif Length = 415 Score = 27.5 bits (58), Expect = 8.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 228 KLIDPVNVTMIKRNDCFHYFKLNPLN 305 KL+ + V + R CF Y+KLN LN Sbjct: 68 KLMFDLEVEIFSRLSCFQYWKLNLLN 93 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,660,600 Number of Sequences: 28952 Number of extensions: 275098 Number of successful extensions: 579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -