BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00048 (381 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) 163 3e-41 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 29 1.7 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 28 2.2 SB_6460| Best HMM Match : SRCR (HMM E-Value=2e-08) 28 2.9 SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 6.8 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.0 >SB_13168| Best HMM Match : Ribosomal_S26e (HMM E-Value=0) Length = 289 Score = 163 bits (397), Expect = 3e-41 Identities = 76/96 (79%), Positives = 83/96 (86%) Frame = +2 Query: 2 RKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMF 181 +KR NGGR+KHGRGHVK VRCTNCARCVPKDK+IKKFVIRNIVEAAAVRDI DASVY ++ Sbjct: 3 KKRCNGGRSKHGRGHVKFVRCTNCARCVPKDKSIKKFVIRNIVEAAAVRDIADASVYEVY 62 Query: 182 QLPKLYAKLHYCVSCAIHSKVVRNNRRKTEESVLLP 289 LPKLY KLHYCVSCAIHSKVVR NR K + + P Sbjct: 63 ALPKLYVKLHYCVSCAIHSKVVR-NRSKEDRKIRTP 97 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 218 VSCAIHSKVVRNNRRKTEESVLLPR 292 VSC + K VR+ +RK EE V L R Sbjct: 376 VSCKMDEKAVRHGKRKGEEEVKLTR 400 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 28.3 bits (60), Expect = 2.2 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 7/49 (14%) Frame = -3 Query: 178 HWVYRGIVN------ISDRRRFYDVPNHELFDSLVLWH-APRAVCASHS 53 H+ RGI N +S+RR+F V N E D +VL H P+A C+ S Sbjct: 441 HYGIRGIANEWFSSYLSNRRQFVSVNNSE-SDEVVLTHGVPQAKCSIQS 488 >SB_6460| Best HMM Match : SRCR (HMM E-Value=2e-08) Length = 234 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 217 RVMRHPQQSCQEQSKKDRRIRTPPKSNFPRDMSRPQAVQR 336 ++ R PQ S Q + RI PP+ + P +S+P + R Sbjct: 182 QISRSPQISESSQISQPPRISQPPQISQPPQISQPPQISR 221 >SB_43935| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 842 Score = 26.6 bits (56), Expect = 6.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 83 VPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 196 + K K + VI + A AV D++ +VYP+F P L Sbjct: 47 IVKKKRNEGKVIYLFIGALAVTDVSLLAVYPLFAFPVL 84 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 26.6 bits (56), Expect = 6.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 217 RVMRHPQQSCQEQSKKDRRIRTPPKSNFPRD 309 R ++HPQ Q +K+ R PPK F R+ Sbjct: 1131 RAIKHPQGDSQWDNKEALRRIMPPKPRFRRN 1161 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 26.2 bits (55), Expect = 9.0 Identities = 9/42 (21%), Positives = 23/42 (54%) Frame = +1 Query: 208 PLLRVMRHPQQSCQEQSKKDRRIRTPPKSNFPRDMSRPQAVQ 333 P+ +R P +S ++ +K+R++ T P + +++ +Q Sbjct: 753 PVKLTIRRPDRSSEKDKEKERKLNTEPPKVVVKPLTKESKLQ 794 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,902,616 Number of Sequences: 59808 Number of extensions: 203143 Number of successful extensions: 529 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 644574580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -