BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00046 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g10500.1 68418.m01216 kinase interacting family protein simil... 31 0.45 At3g22450.1 68416.m02837 expressed protein ; expression supporte... 30 0.79 At1g68910.1 68414.m07886 expressed protein similar to Myosin hea... 30 0.79 At5g07660.1 68418.m00877 structural maintenance of chromosomes (... 29 1.4 At3g58240.1 68416.m06493 meprin and TRAF homology domain-contain... 29 1.4 At4g30350.1 68417.m04313 heat shock protein-related contains sim... 29 1.8 At1g04160.1 68414.m00406 myosin family protein contains Pfam pro... 29 1.8 At5g38190.1 68418.m04602 myosin heavy chain-related 29 2.4 At2g37370.1 68415.m04583 hypothetical protein 29 2.4 At5g13130.1 68418.m01504 hypothetical protein low similarity to ... 28 3.2 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 28 3.2 At1g48620.1 68414.m05439 histone H1/H5 family protein weak simil... 28 4.2 At5g40400.1 68418.m04900 pentatricopeptide (PPR) repeat-containi... 27 5.5 At4g27500.1 68417.m03950 expressed protein non-consensus GA dono... 27 5.5 At4g20860.1 68417.m03026 FAD-binding domain-containing protein s... 27 5.5 At1g37000.1 68414.m04612 hypothetical protein 27 5.5 At5g55820.1 68418.m06956 expressed protein 27 7.3 At4g00900.1 68417.m00122 calcium-transporting ATPase 2, endoplas... 27 7.3 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 27 9.7 At5g27330.1 68418.m03263 expressed protein 27 9.7 At3g13000.2 68416.m01620 expressed protein contains Pfam profile... 27 9.7 At3g13000.1 68416.m01619 expressed protein contains Pfam profile... 27 9.7 At1g69730.1 68414.m08024 protein kinase family protein contains ... 27 9.7 >At5g10500.1 68418.m01216 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 848 Score = 31.1 bits (67), Expect = 0.45 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 9 DEMTTKLMTIENIIQREKEGQSTIPDLLSNITNIQKLITKTEQKIKNSN 155 DE+ + + I REK + +L N ++KL+ +TE K+KN N Sbjct: 539 DELFLQKLLAHGIEGREKHLLTEYTKVLRNYKEVKKLLHETETKLKNVN 587 >At3g22450.1 68416.m02837 expressed protein ; expression supported by MPSS Length = 311 Score = 30.3 bits (65), Expect = 0.79 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +2 Query: 98 YNKHTKTYHKNRTKNKKQQQASK*CDSQNKSRKRHFGWYKKRN 226 Y+ H K HKN K + Q++ +K NK R YKKRN Sbjct: 125 YDFHRKNQHKNAKKEQNQEEETK-IKKDNKKEVR--DEYKKRN 164 >At1g68910.1 68414.m07886 expressed protein similar to Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) (Swiss-Prot:Q27991) [Bos taurus]; contains 1 transmembrane domain Length = 627 Score = 30.3 bits (65), Expect = 0.79 Identities = 13/57 (22%), Positives = 32/57 (56%) Frame = +3 Query: 9 DEMTTKLMTIENIIQREKEGQSTIPDLLSNITNIQKLITKTEQKIKNSNRHLNDVTA 179 ++ T +L + ++Q+ + S +++S + +++ + EQK+KN++ L V A Sbjct: 280 EDCTVQLEAKDLLVQKLEGTISENSEIVSEVLTLREYVKSAEQKLKNTDLELKSVNA 336 >At5g07660.1 68418.m00877 structural maintenance of chromosomes (SMC) family protein similar to SMC-like protein (MIM) [Arabidopsis thaliana] GI:5880614; contains Pfam profile PF02463: RecF/RecN/SMC N terminal domain Length = 1058 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 4/82 (4%) Frame = +3 Query: 9 DEMTTKLMTIENIIQREKEGQSTIPDLLS----NITNIQKLITKTEQKIKNSNRHLNDVT 176 +++T ++ E+++ KE ++ + + S +I+++I E+K +N N H+ND+ Sbjct: 384 NQLTVEVEKAESLVSSLKEEENMVMEKASAGGKEKEHIEEMIRDHEKKQRNMNAHINDL- 442 Query: 177 AKINLGNVTLDGIRKETDKLKS 242 K VT G K + L++ Sbjct: 443 KKHQTNKVTAFGGDKVINLLRA 464 >At3g58240.1 68416.m06493 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 317 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 36 IENIIQREKEGQSTIPDLLSNITNIQKLITKTEQKIKNSN 155 I+ +R E + + DL++ TN+ KL+ K + +IKN++ Sbjct: 268 IKKKCERVTEMEKELHDLMNKHTNVSKLLEKEKLEIKNAS 307 >At4g30350.1 68417.m04313 heat shock protein-related contains similarity to heat shock protein 101 [Triticum aestivum] gi|6013196|gb|AAF01280 Length = 924 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 365 QNDIAKTDRQLKNTDRLIEMQYGNFNTTQNVNDKKLTQMQEQVD 496 +ND+AK ++ L +R + Q+ + DKKLT+ Q+ V+ Sbjct: 445 ENDVAKVEKDLTGDNRSVLPQWLQNAKANDDGDKKLTKDQQIVE 488 >At1g04160.1 68414.m00406 myosin family protein contains Pfam profiles: PF02736 myosin N-terminal SH3-like domain, PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif, PF01843: DIL domain Length = 1500 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/61 (19%), Positives = 30/61 (49%) Frame = +3 Query: 9 DEMTTKLMTIENIIQREKEGQSTIPDLLSNITNIQKLITKTEQKIKNSNRHLNDVTAKIN 188 +E+ K E ++ +E+E T+ ++L I + + + +K+ N N L + + + Sbjct: 931 EEIQNKFKETEALLIKEREAAKTVSEVLPIIKEVPVVDQELMEKLTNENEKLKGMVSSLE 990 Query: 189 L 191 + Sbjct: 991 I 991 >At5g38190.1 68418.m04602 myosin heavy chain-related Length = 969 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 96 NITNIQKLITKTEQKIKNSNRHLNDVTAKINLGNVTLDGIRKETDKLKSK 245 N+ + ++ I E K+KN+ R + D + G L ++KET LK++ Sbjct: 515 NLRSAREKILVLEGKLKNAERTIADNNQQAKAGLEELKALKKETVVLKAE 564 >At2g37370.1 68415.m04583 hypothetical protein Length = 697 Score = 28.7 bits (61), Expect = 2.4 Identities = 18/91 (19%), Positives = 42/91 (46%) Frame = +2 Query: 233 IKIESYRLGNNATKLQEANLEGALNLTREAKHRAVKALNDANHLQNDIAKTDRQLKNTDR 412 +K+ S L N+ +K ++ ++ + + EA V + L+ D+A ++L+ Sbjct: 305 LKVLSESLLNSTSKAEKRIMDHSRSQKEEALSYRVSKTTEVGQLEKDVAAELKKLEILKE 364 Query: 413 LIEMQYGNFNTTQNVNDKKLTQMQEQVDRLE 505 +E + NT+ +L QE+ ++ + Sbjct: 365 DLEAELKRVNTSITSARARLRNAQEEREQFD 395 >At5g13130.1 68418.m01504 hypothetical protein low similarity to microrchidia [Mus musculus] GI:5410255 Length = 706 Score = 28.3 bits (60), Expect = 3.2 Identities = 27/90 (30%), Positives = 37/90 (41%), Gaps = 7/90 (7%) Frame = +3 Query: 3 DFDEMTTKLMTIENIIQREKEGQSTIPDLLSNITNIQKLITKTE--QKIKNSNRHLNDVT 176 + E K+ +E QREKE L + IQ L + E I R DVT Sbjct: 619 ELQESKAKIQNLEKA-QREKEVLEL--QLKESKARIQNLENRQEGVSTIFQQERARRDVT 675 Query: 177 A-----KINLGNVTLDGIRKETDKLKSKAI 251 K+ + +DG+RK+ D K K I Sbjct: 676 EDGLRKKLREASDVIDGLRKQVDTFKGKRI 705 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 28.3 bits (60), Expect = 3.2 Identities = 19/88 (21%), Positives = 43/88 (48%) Frame = +2 Query: 113 KTYHKNRTKNKKQQQASK*CDSQNKSRKRHFGWYKKRNR*IKIESYRLGNNATKLQEANL 292 + Y + + K +++A + + N+ K + ++NR + ++ ++ + L E +L Sbjct: 816 RVYEETQLKTA-EKEAEERLELSNQLAKLKYQLEYEQNRDVGSRIRKIESSISSL-ETDL 873 Query: 293 EGALNLTREAKHRAVKALNDANHLQNDI 376 EG E K AVK N+ N+ + ++ Sbjct: 874 EGIQKTMSERKETAVKITNEINNWKKEM 901 >At1g48620.1 68414.m05439 histone H1/H5 family protein weak similarity to HMG I/Y like protein [Glycine max] GI:15706274, HMG-I/Y protein HMGa [Triticum aestivum] GI:20502966; contains Pfam profiles PF00538: linker histone H1 and H5 family, PF02178: AT hook motif Length = 479 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +2 Query: 233 IKIESYRLGNNATKLQEANLEGALNLTREAKHRAVKALNDANHLQND 373 +K E GN A +LEG T E KH L D HL+ + Sbjct: 414 LKSEIGGSGNQAVVQAIQDLEGIAETTNEPKHMEEVQLPDEEHLETE 460 >At5g40400.1 68418.m04900 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 686 Score = 27.5 bits (58), Expect = 5.5 Identities = 19/77 (24%), Positives = 34/77 (44%), Gaps = 6/77 (7%) Frame = +3 Query: 57 EKEGQSTIPDLLSNITNIQKLITKTEQ------KIKNSNRHLNDVTAKINLGNVTLDGIR 218 E+EG P+ +N+ E+ K+KN N+ L+ T + +G + G Sbjct: 478 EEEGHEAKPETYNNLIESLSRCDAIEEALVLKGKLKNQNQVLDAKTYRALIGCLCRIGRN 537 Query: 219 KETDKLKSKAID*ETTP 269 +E + L ++ D E P Sbjct: 538 REAESLMAEMFDSEVKP 554 >At4g27500.1 68417.m03950 expressed protein non-consensus GA donor splice site at exon 6 Length = 612 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 138 KIKNSNRHLNDVTAKINLGNVTLDGIRKETDKLKSK 245 KIK S +D+ ++ L LDG++KE + ++ Sbjct: 229 KIKESMGQKDDIQGQVKLMGAGLDGVKKERQAISAR 264 >At4g20860.1 68417.m03026 FAD-binding domain-containing protein simlar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 530 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +3 Query: 6 FDEMTTKLMTIENI---IQREKEGQSTIPDLLSNITNIQKLITKTEQKIKNSNRHL 164 F E T LM E + I + E +S P N+ NIQ ++ +++ N+H+ Sbjct: 394 FLEQDTPLMIFEPLGGKISKISETESPYPHRRGNLYNIQYMVKWKVNEVEEMNKHV 449 >At1g37000.1 68414.m04612 hypothetical protein Length = 219 Score = 27.5 bits (58), Expect = 5.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 508 SFKSIYLFLHLGKFFIIYILSS 443 S +IYLF+ LG ++Y+L+S Sbjct: 183 SISTIYLFVALGNVLLVYVLNS 204 >At5g55820.1 68418.m06956 expressed protein Length = 1826 Score = 27.1 bits (57), Expect = 7.3 Identities = 24/96 (25%), Positives = 43/96 (44%), Gaps = 2/96 (2%) Frame = +2 Query: 104 KHTKTYHKNRTKNKKQQQASK*CDSQNKSRKRHFGWYKKRNR*IKIESYRLGNNATKLQE 283 K + K + KK+++ K + + RKR KR + K + R+ + + +E Sbjct: 1575 KEAEMAWKQEMEKKKKEEERKRKEFEMADRKRQREEEDKRLKEAK-KRQRIADFQRQQRE 1633 Query: 284 AN--LEGALNLTREAKHRAVKALNDANHLQNDIAKT 385 A+ L+ L R+A +KA + QN+ KT Sbjct: 1634 ADEKLQAEKELKRQAMDARIKAQKELKEDQNNAEKT 1669 >At4g00900.1 68417.m00122 calcium-transporting ATPase 2, endoplasmic reticulum-type (ECA2) nearly identical to SP|O23087 Calcium-transporting ATPase 2, endoplasmic reticulum-type (EC 3.6.3.8) {Arabidopsis thaliana}; contains InterPro Accession IPR006069: Cation transporting ATPase Length = 1054 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 278 QEANLEGALNLTREAKHRAVKALNDANHLQN 370 QE+N E AL +E + + K L D N L N Sbjct: 116 QESNAEKALEALKEMQCESAKVLRDGNVLPN 146 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 26.6 bits (56), Expect = 9.7 Identities = 18/83 (21%), Positives = 34/83 (40%) Frame = +2 Query: 257 GNNATKLQEANLEGALNLTREAKHRAVKALNDANHLQNDIAKTDRQLKNTDRLIEMQYGN 436 G+ + EA E N+ + K A+K N+A + + ++K ++ +++ Sbjct: 171 GDKGDDVDEA--EKVENVDEDDKEEALKEKNEAELAEEEETNKGEEVKEANKEDDVEADT 228 Query: 437 FNTTQNVNDKKLTQMQEQVDRLE 505 V DKK E D+ E Sbjct: 229 KVAEPEVEDKKTESKDENEDKEE 251 >At5g27330.1 68418.m03263 expressed protein Length = 628 Score = 26.6 bits (56), Expect = 9.7 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 3/79 (3%) Frame = +2 Query: 278 QEANLEGALNLTREAKHRAVKALNDANHLQNDIAKTD---RQLKNTDRLIEMQYGNFNTT 448 QEA + L E KH + D N + K + QLK+ L+E++ N Sbjct: 387 QEAEIVELSKLAGEQKHAVAQLRKDYNDQIKNGEKLNCNVSQLKDALALVEVERDNAGKA 446 Query: 449 QNVNDKKLTQMQEQVDRLE 505 + + + ++E+V LE Sbjct: 447 LDEEKRNMVALKEKVVALE 465 >At3g13000.2 68416.m01620 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 582 Score = 26.6 bits (56), Expect = 9.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 84 DLLSNITNIQKLITKTEQKIKNSNRHLN 167 +LLSNI ++ +TK EQ++ + N L+ Sbjct: 96 ELLSNIVTLETAVTKLEQEMMSLNFQLS 123 >At3g13000.1 68416.m01619 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 553 Score = 26.6 bits (56), Expect = 9.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 84 DLLSNITNIQKLITKTEQKIKNSNRHLN 167 +LLSNI ++ +TK EQ++ + N L+ Sbjct: 67 ELLSNIVTLETAVTKLEQEMMSLNFQLS 94 >At1g69730.1 68414.m08024 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 792 Score = 26.6 bits (56), Expect = 9.7 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = -3 Query: 64 SFSLWIMFSMVINFVVISS 8 SFSLWI+FS+ + F++ S+ Sbjct: 6 SFSLWILFSLQLCFILDSA 24 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,888,514 Number of Sequences: 28952 Number of extensions: 142909 Number of successful extensions: 510 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -