BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00041 (817 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 27 0.18 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 23 2.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.1 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 5.1 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 27.1 bits (57), Expect = 0.18 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 607 NFVKIPGR-YFPLEIDYGDNETKTLTVDPKCELAEPVQRLIVTIFDIHYMKQTCSNSS 777 NFV + G Y L I +N+ K T L ++ ++ IF+++Y+ C N S Sbjct: 224 NFVVLLGDLYVTLYIILTNNQAKYCTT-----LIGLIKNCVIVIFELYYLSHVCQNVS 276 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +3 Query: 36 DVDKMSPKMQSIQYLDIVVLDESFLNSIDPETGTVARSLELMKEYNIADW 185 ++ K SP+MQS + + S +S+ A L EYN +W Sbjct: 237 NIKKESPQMQSYRPTGNITPHGSNTSSLITTPSPSASPLAYQHEYNSFNW 286 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 497 CRSDPTNGTTSICSLYYVSRSAV 429 CRS+ C+ YYV RS + Sbjct: 560 CRSEGIFSDPKNCAAYYVCRSGL 582 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 603 PVFPTVLSFFFVQRLESVQSVIEIFHLL 520 P F L FF + L +V + IF++L Sbjct: 162 PAFSHFLIVFFTETLHTVGIALLIFYIL 189 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 603 PVFPTVLSFFFVQRLESVQSVIEIFHLL 520 P F L FF + L +V + IF++L Sbjct: 162 PAFSHFLIVFFTETLHTVGIALLIFYIL 189 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 603 PVFPTVLSFFFVQRLESVQSVIEIFHLL 520 P F L FF + L +V + IF++L Sbjct: 162 PAFSHFLIVFFTETLHTVGIALLIFYIL 189 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 603 PVFPTVLSFFFVQRLESVQSVIEIFHLL 520 P F L FF + L +V + IF++L Sbjct: 162 PAFSHFLIVFFTETLHTVGIALLIFYIL 189 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,752 Number of Sequences: 336 Number of extensions: 3617 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -