BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00041 (817 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 24 4.9 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 8.5 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 24.2 bits (50), Expect = 4.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 36 DVDKMSPKMQSIQYLDIVVLDESFLNSIDPETGTVAR 146 DV + SP+ S++Y+D VL E + G V+R Sbjct: 20 DVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSR 56 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 8.5 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 597 FPTVLSFFFVQRLESVQSVIEIFHLLDFTAPI 502 F V FFF + + V++V + + L+ +PI Sbjct: 402 FNAVDGFFFYEDVNKVETVTDAYIKLELKSPI 433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 795,041 Number of Sequences: 2352 Number of extensions: 15667 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -