BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00035 (728 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 147 9e-36 SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) 145 4e-35 SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 6e-27 SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 3e-26 SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) 95 5e-20 SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) 83 2e-16 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 82 4e-16 SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) 77 1e-14 SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) 76 3e-14 SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) 52 4e-07 SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) 37 0.015 SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) 32 0.55 SB_24760| Best HMM Match : PT (HMM E-Value=0.17) 31 0.72 SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.72 SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) 31 0.96 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) 30 1.7 SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) 30 1.7 SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 28 8.9 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 147 bits (356), Expect = 9e-36 Identities = 69/109 (63%), Positives = 82/109 (75%) Frame = +3 Query: 183 QGLHFPSCHPQFHAARRGLHQP*RTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTN 362 +G F PQF + TGGKSIYG KFEDENF LKHTG GVLSMAN+G +TN Sbjct: 182 KGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTN 241 Query: 363 GSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSKRIV 509 GSQFF+TT KT WLDG+HVVFGNV+EG +VV+++E GSQSGK SK++V Sbjct: 242 GSQFFLTTEKTDWLDGKHVVFGNVIEGFDVVRKMEAVGSQSGKASKKVV 290 Score = 119 bits (287), Expect = 2e-27 Identities = 51/71 (71%), Positives = 57/71 (80%) Frame = +1 Query: 49 PRVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQ 228 PRVFFD+T+ + G+IV+ELRSDV P T ENFR LCT EKGFGYKGS FHR+IP FM Q Sbjct: 137 PRVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQ 196 Query: 229 GGDFTNHNGLG 261 GGDFT HNG G Sbjct: 197 GGDFTKHNGTG 207 >SB_31360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 145 bits (351), Expect = 4e-35 Identities = 65/85 (76%), Positives = 74/85 (87%) Frame = +3 Query: 255 TGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNV 434 TGGKSIYG KF DENF LKHTGPG+LSMANAG TNGSQFF+ T KTSWLDG+HVVFG+V Sbjct: 72 TGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSV 131 Query: 435 VEGMEVVKQIETFGSQSGKTSKRIV 509 +GM+VVK+IE GS SGKTSK++V Sbjct: 132 KDGMDVVKKIEKVGSDSGKTSKKVV 156 Score = 113 bits (272), Expect = 1e-25 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = +1 Query: 58 FFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGD 237 +FD+ + AP G+IV+ELR DV PKT ENFRALCTGEKGFGYKGS FHRVIP FM QGGD Sbjct: 6 YFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGFMCQGGD 65 Query: 238 FTNHNGLG 261 FT +G G Sbjct: 66 FTRGDGTG 73 >SB_24677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 118 bits (283), Expect = 6e-27 Identities = 54/66 (81%), Positives = 57/66 (86%) Frame = +3 Query: 255 TGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNV 434 TGGKSIYG KF DENF L+H G G LSMANAG DTNGSQFFITTVKT WLDGRHVVFG V Sbjct: 114 TGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKV 173 Query: 435 VEGMEV 452 ++GMEV Sbjct: 174 LKGMEV 179 Score = 57.2 bits (132), Expect = 1e-08 Identities = 37/88 (42%), Positives = 49/88 (55%), Gaps = 18/88 (20%) Frame = +1 Query: 52 RVFFDVTVDDAPLGKI------VIELRSDVTPKTCE-----NFRAL-----CT--GEKGF 177 +VFFD+T+ G+I +I+ + + E NFR CT +KGF Sbjct: 28 KVFFDITIGGEKAGRIEIGLFVIIKTYYLLATRLVESLIGTNFRYFDTYYCCTIESQKGF 87 Query: 178 GYKGSIFHRVIPNFMLQGGDFTNHNGLG 261 GYK SIFHRVI +FM+QGGDFT +G G Sbjct: 88 GYKNSIFHRVIQDFMIQGGDFTKGDGTG 115 >SB_24678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 116 bits (278), Expect = 3e-26 Identities = 51/71 (71%), Positives = 59/71 (83%) Frame = +3 Query: 255 TGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNV 434 TGG SIYG F+DENF LKH GPG L MANAG +TNGSQF+ITT+KTSWLDG H FG V Sbjct: 95 TGGYSIYGKYFDDENFNLKHYGPGWLCMANAGKNTNGSQFYITTIKTSWLDGSHTCFGKV 154 Query: 435 VEGMEVVKQIE 467 +EGM+VV++IE Sbjct: 155 LEGMDVVRRIE 165 Score = 89.8 bits (213), Expect = 2e-18 Identities = 39/70 (55%), Positives = 50/70 (71%) Frame = +1 Query: 52 RVFFDVTVDDAPLGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQG 231 +V+ DV++ P G++++ L D PKT NF AL E+GFGYK SIFHRVI NFM+QG Sbjct: 27 KVWMDVSIGGQPAGRVILGLFGDTAPKTVANFVALADKEQGFGYKDSIFHRVIKNFMIQG 86 Query: 232 GDFTNHNGLG 261 GDFTN +G G Sbjct: 87 GDFTNKDGTG 96 >SB_51693| Best HMM Match : Pro_isomerase (HMM E-Value=3.5e-19) Length = 99 Score = 95.1 bits (226), Expect = 5e-20 Identities = 44/71 (61%), Positives = 55/71 (77%), Gaps = 1/71 (1%) Frame = +3 Query: 255 TGGKSIYGNKFEDE-NFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGN 431 TGG+SI+G +FEDE + L+H P +SMANAG +TNGSQFFIT V T WLD +H VFG Sbjct: 4 TGGESIWGGEFEDEFHRNLRHDRPYTVSMANAGPNTNGSQFFITVVPTPWLDNKHTVFGR 63 Query: 432 VVEGMEVVKQI 464 VV+GM+V +QI Sbjct: 64 VVKGMDVAQQI 74 >SB_24676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 83.8 bits (198), Expect = 1e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = +3 Query: 336 MANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 467 MANAG DTNGSQFFITTVKTSWLDG+HVVFG V+EGM+VV+++E Sbjct: 1 MANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLE 44 >SB_25950| Best HMM Match : Pro_isomerase (HMM E-Value=2.5e-24) Length = 145 Score = 83.4 bits (197), Expect = 2e-16 Identities = 35/70 (50%), Positives = 49/70 (70%) Frame = +3 Query: 258 GGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVV 437 GG+S+YG FEDE+F++ H GV+ MAN G TNGSQF+IT W+D ++V FG V+ Sbjct: 48 GGESVYGPLFEDEDFSVAHNRRGVVGMANKGRHTNGSQFYITLQPAPWMDTKYVAFGQVI 107 Query: 438 EGMEVVKQIE 467 EG+ V+ +E Sbjct: 108 EGLNVLDVLE 117 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 82.2 bits (194), Expect = 4e-16 Identities = 36/53 (67%), Positives = 46/53 (86%) Frame = +3 Query: 309 KHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQIE 467 +H PG+LSMAN+G +TNGSQFFITTV T LDGRHVVFG V++GM+VV+++E Sbjct: 188 EHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELE 240 >SB_3070| Best HMM Match : Pro_isomerase (HMM E-Value=2.3e-05) Length = 49 Score = 77.4 bits (182), Expect = 1e-14 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = +3 Query: 327 VLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNVVEGMEVVKQI 464 +LSMANAG TNGSQFF+ T KTSWLDG+HVVFG+V +GM+VVK++ Sbjct: 2 ILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKM 47 >SB_32917| Best HMM Match : Pro_isomerase (HMM E-Value=5.1e-23) Length = 378 Score = 76.2 bits (179), Expect = 3e-14 Identities = 40/72 (55%), Positives = 49/72 (68%) Frame = +3 Query: 255 TGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFGNV 434 TGG+SIYG F DE F KH P +LSMAN G +TNGSQFFI HVVFG+V Sbjct: 27 TGGESIYGGTFGDECFEFKHERPMLLSMANRGPNTNGSQFFII----------HVVFGHV 76 Query: 435 VEGMEVVKQIET 470 ++G E+V+QIE+ Sbjct: 77 IQGEELVRQIES 88 >SB_21081| Best HMM Match : Pro_isomerase (HMM E-Value=0.11) Length = 48 Score = 52.4 bits (120), Expect = 4e-07 Identities = 26/46 (56%), Positives = 30/46 (65%), Gaps = 8/46 (17%) Frame = +1 Query: 91 GKIVIELRSDVTPKTCENFRALCTGEKGFG--------YKGSIFHR 204 G+++ EL +D PKT ENFRALCTGEKG G YKG FHR Sbjct: 2 GRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHR 47 >SB_23239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 48.0 bits (109), Expect = 8e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = +1 Query: 88 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVIPNFMLQGGDF 240 LG+I IEL +D P + NF A + G+ Y G+ FHRVIP FM+QGG F Sbjct: 32 LGEIEIELDADKAPISTANFLAYV--DSGY-YAGTQFHRVIPGFMVQGGGF 79 Score = 33.9 bits (74), Expect = 0.14 Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 6/57 (10%) Frame = +3 Query: 312 HTGPGVLSMANAGA-DTNGSQFFITTVKTSWLDGR-----HVVFGNVVEGMEVVKQI 464 H G L+MA D+ SQFFI ++LD + VFG VV+GM+VV +I Sbjct: 101 HNVRGTLAMARTQVRDSATSQFFINHKDNAFLDHGSRDFGYAVFGKVVKGMDVVDKI 157 >SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1651 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = +3 Query: 312 HTGPGVLSMANAGADTNGSQFFITTVKTSWLDGRHVVFG 428 H G +SMAN G ++NGSQFFI K LD ++ +FG Sbjct: 301 HNARGTVSMANNGPNSNGSQFFICYGKQPHLDMKYTMFG 339 >SB_42464| Best HMM Match : Pro_isomerase (HMM E-Value=3.9e-06) Length = 454 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +1 Query: 88 LGKIVIELRSDVTPKTCENFRALCTGEKGFGYKGSIFHRVI 210 +G I IEL TPK C NF LC +G+ Y +IFHR++ Sbjct: 12 VGDIDIELWGKETPKACRNFIQLCL--EGY-YDNTIFHRIV 49 >SB_6440| Best HMM Match : DUF638 (HMM E-Value=6.2) Length = 175 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/19 (63%), Positives = 18/19 (94%) Frame = +3 Query: 414 HVVFGNVVEGMEVVKQIET 470 HVVFG+V++G E+V+QIE+ Sbjct: 3 HVVFGHVIQGEELVRQIES 21 >SB_24760| Best HMM Match : PT (HMM E-Value=0.17) Length = 422 Score = 31.5 bits (68), Expect = 0.72 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -2 Query: 454 TTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 317 TT PST P T PS+ E +T WEP P PGP Sbjct: 34 TTGEPSTWEPMTGA-PSTWEPMTGAPSTWEPWTDGPGPYPTDGPGP 78 Score = 31.1 bits (67), Expect = 0.96 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 427 PKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 317 P TT PS+ E +T WEP+ AP+ T GP Sbjct: 32 PFTTGEPSTWEPMTGAPSTWEPMTGAPSTWEPWTDGP 68 >SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 31.5 bits (68), Expect = 0.72 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -2 Query: 457 LTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 317 L+ + + FP TT P + + T + EPL+ P +R P P Sbjct: 13 LSATQLTAAFPTTTTTPVTTQTTTTDVSRTEPLIELPTAQEKRKPCP 59 >SB_40118| Best HMM Match : DREPP (HMM E-Value=0.085) Length = 512 Score = 31.1 bits (67), Expect = 0.96 Identities = 23/57 (40%), Positives = 30/57 (52%) Frame = -1 Query: 488 PRLAAKGLNLLDNFHAFNNIPKDNMSAIQPGGLDSGDEELGTISISTGISHGEDARS 318 PR A +GL D F+ K+ MS I+PGG D +EE T S G + E A+S Sbjct: 443 PRRAGEGLPHSDFKSGFSY--KEYMSGIRPGGPDMEEEEKATPQ-SNGDASDEKAQS 496 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 201 SCHPQFHAARRGLHQP*RTGGKSIYGNKFEDE 296 S HP H RG + P R+ +SI KF+DE Sbjct: 8 SQHPMEHLESRGHNTPRRSSSRSIKRKKFDDE 39 >SB_19689| Best HMM Match : VWA (HMM E-Value=0.0035) Length = 885 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 82 APLGKIVIELRSDVTPKTCENFRALCTG 165 AP I+I L S V+PKT E+ R LC G Sbjct: 569 APKIDIIIALDSGVSPKTFEDERQLCAG 596 >SB_3760| Best HMM Match : SVA (HMM E-Value=0.19) Length = 259 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = -2 Query: 430 FPKTTCLPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 317 FP+ + LP S E +LT++++N P ++APA + P P Sbjct: 81 FPQPSLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_19447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1110 Score = 29.5 bits (63), Expect = 2.9 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 5/43 (11%) Frame = -2 Query: 430 FPKTTCLPSSQE-----VLTVVMKNWEPLVSAPALAMERTPGP 317 FP+ LP S E +LT++++N P ++APA + P P Sbjct: 81 FPQPPLLPPSSESFDITLLTILLRNICPTLTAPATGWDALPAP 123 >SB_51093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = -2 Query: 475 PKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGPVCLRVKF 296 P+ TTS PST+ P+T ++ T N AP+ + RT + LR Sbjct: 87 PRTGSTTTTSAPSTSTPRTGSTTTTSAPSTSTTSN--STTRAPSTSTPRTGSTITLRTST 144 Query: 295 SS 290 +S Sbjct: 145 TS 146 >SB_30500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2014 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -1 Query: 161 VHRARKFSHVLGV--TSLLSSITIFPSGASSTVTSKNTRGRDILPV 30 + + KF+H+ G+ TS T+F +T T TR RD++ + Sbjct: 168 IQQLHKFTHIHGMLSTSSRGRYTLFRGQYDTTATQIYTRSRDVIDI 213 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 27.9 bits (59), Expect = 8.9 Identities = 16/57 (28%), Positives = 23/57 (40%) Frame = -2 Query: 487 PDWLPKVSICLTTSMPSTTFPKTTCLPSSQEVLTVVMKNWEPLVSAPALAMERTPGP 317 P P + TT+ P TT P+TT P + T + P + P +T P Sbjct: 1767 PPHSPPTTTTTTTTTPETTAPRTT-TPETTTPETTTPRTTTPETTKPRTTTPKTTTP 1822 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,740,750 Number of Sequences: 59808 Number of extensions: 535681 Number of successful extensions: 1526 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1521 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -