BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00035 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 4.2 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.5 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 24 5.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.7 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 9.7 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 4.2 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +2 Query: 362 WFPVLHHHCQD 394 W+P + HHC D Sbjct: 100 WYPEIKHHCPD 110 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 396 SWLDGRHVVFGNVVEGMEVVKQIETFGSQSGKTSK 500 SWL HV V E +V+ +GS S +T+K Sbjct: 3198 SWLLLAHVAPAAVREVKRIVQNFFGWGSSSSRTTK 3232 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 128 PRRVKTSVPCALARKASVTRAPFSIVSSPISCCKEG 235 P ++K S+P K S T P+S P C G Sbjct: 307 PIKLKLSLPYVEREKCSKTFRPWSFALGPGQMCAGG 342 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 82 HRQQ*RRRILVVETFCRY*QCKQFTK 5 H QQ + ++ FCR +CK+ K Sbjct: 427 HHQQVHNQQRILYCFCRNVECKELEK 452 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 457 LTTSMPSTTFPKTTCLPSSQEVLTV 383 L+ ++ T F + CLP+S+E TV Sbjct: 226 LSETVEFTDFIRPICLPTSEESRTV 250 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,483 Number of Sequences: 2352 Number of extensions: 17635 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -