BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00033 (348 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 36 6e-04 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 29 0.065 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 26 0.35 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 25 1.1 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 25 1.1 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 25 1.1 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 25 1.1 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 25 1.1 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 25 1.1 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 25 1.1 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 25 1.1 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 25 1.1 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 25 1.1 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 25 1.1 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 25 1.1 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 25 1.1 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 25 1.1 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 25 1.1 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 25 1.1 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 25 1.1 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 25 1.1 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 25 1.1 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 22 5.7 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 21 9.9 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 35.5 bits (78), Expect = 6e-04 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 2/86 (2%) Frame = +1 Query: 1 EELITVSR-DRDNFQLKYVSAETTLKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALK 177 EEL + D+ L+YV ET LKE+ KQ +E+L+ Q + +K LL EI + Sbjct: 208 EELSEYQKWDKARRTLEYVIYETELKETRKQ---LEELDGQRKSSGDKQLLLTQEIQKAQ 264 Query: 178 DALRQ-MKHDPSSNVDVASLIDHAEI 252 D L+ K + DV + D + Sbjct: 265 DRLKNAQKALKDAKKDVVTAKDEKSV 290 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 28.7 bits (61), Expect = 0.065 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 1 EELITVSRDRDNFQLKYVSAETTLKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKD 180 E L SR+ ++ + +A+ K +E+ K E + K+ + TKN L HE D L Sbjct: 1424 EALYAASRNAEDARKNAQTAQD--KYAEEASKLAENIKKRANATKNTARDLHHEADQLNG 1481 Query: 181 AL 186 L Sbjct: 1482 RL 1483 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 26.2 bits (55), Expect = 0.35 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Frame = +1 Query: 109 LNKQLSETKNKNELLQHEIDALK----DALRQMKHD 204 L + L ET+ KNE LQ ++ L+ + LR+ + D Sbjct: 41 LRQNLEETRKKNESLQEQLTQLRWLMEEKLREQRED 76 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 317 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 356 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 Query: 70 LKESEKQVKEIEQLNKQLSETKNKNELLQHEIDALKDALR 189 LK E + + + E + +N+ Q EIDALK+ R Sbjct: 332 LKRKEHALLSGQGSETERLECERENQARQREIDALKEQYR 371 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 24.6 bits (51), Expect = 1.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 76 ESEKQVKEIEQLNKQLSETKNKNELLQHEIDALK 177 E EKQ K++E+ + L E+ +KN + E D K Sbjct: 39 EVEKQSKKLEKRKETLGESLDKNHKKKIERDEEK 72 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 25 DRDNFQLKYVSAETTLKESEKQVKEIEQLNKQLSETKNK 141 D N++L + ++ +EIE+LNK++ ET K Sbjct: 718 DMLNYELNNLKQRLAQTSFQQTKEEIEELNKKI-ETLQK 755 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 21.4 bits (43), Expect = 9.9 Identities = 11/70 (15%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Frame = +1 Query: 1 EELITVSRDRDNFQLKYVSAETTLKESEKQVK----EIEQLNKQLSETKNKNELLQHEID 168 +++ +S + ++ ++E +++S+ ++ E+E + + ++ L+ E + Sbjct: 907 KQIDKLSANISKLTVEIKTSERNVQKSKDKINSMEDEVEAAQSAIRKGNDERTQLEEEAN 966 Query: 169 ALKDALRQMK 198 L++ L +MK Sbjct: 967 KLREELEEMK 976 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 280,077 Number of Sequences: 2352 Number of extensions: 4412 Number of successful extensions: 46 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -