BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00032 (558 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0037 + 13992103-13992624,13993001-13993180,13993423-139936... 27 7.7 02_05_1067 - 33858215-33858321,33858422-33858527,33859014-338592... 27 7.7 >09_04_0037 + 13992103-13992624,13993001-13993180,13993423-13993691, 13994120-13995773 Length = 874 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 264 SPVSSWSNVGRTGDVLPTPLSNVETRPSP 350 +PVSS+ GR + PTP +N + RP P Sbjct: 505 TPVSSFQR-GRAVTMTPTPQNNPQRRPPP 532 >02_05_1067 - 33858215-33858321,33858422-33858527,33859014-33859218, 33859463-33859650,33859780-33859957,33860201-33860298, 33860619-33860873,33861002-33861236,33861846-33861973 Length = 499 Score = 27.5 bits (58), Expect = 7.7 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = +1 Query: 184 FLHLVALGVLAAIVRDPRLLDELDVSHPQ*VRGAMWGALEMYCPHHCQMWKLVPAHTLNM 363 F L + + A + +DP L +L++ HP + G P Q +KLV L Sbjct: 250 FPRLAKIVLSATLTQDPSKLSQLELQHPLLLNS---GKKRYRIPTKLQSYKLVCKSNLKP 306 Query: 364 LHILV 378 L ++V Sbjct: 307 LSLIV 311 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,748,970 Number of Sequences: 37544 Number of extensions: 416078 Number of successful extensions: 1215 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1215 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -